CYP26B1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis with CYP26B1 polyclonal antibody (Cat # PAB30589).
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Western Blot
Western Blot analysis with CYP26B1 polyclonal antibody (Cat # PAB30589).
Lane 1: Human cell line RT-4
Lane 2: Human cell line U-251MG sp
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human liver with CYP26B1 polyclonal antibody (Cat # PAB30589) shows cytoplasmic and membranous positivity in hepatocytes.
Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with CYP26B1 polyclonal antibody (Cat # PAB30589) shows positivity in cytoplasm. Antibody staining is shown in green.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human CYP26B1.
Immunogen
Recombinant protein corresponding to amino acids 201-310 of human CYP26B1.
Sequence
SIPEEDLGHLFEVYQQFVDNVFSLPVDLPFSGYRRGIQARQILQKGLEKAIREKLQCTQGKDYLDALDLLIESSKEHGKEMTMQELKDGTLELIFAAYATTASASTSLIM
Host
Rabbit
Reactivity
Human, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis with CYP26B1 polyclonal antibody (Cat # PAB30589).
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)Western Blot
Western Blot analysis with CYP26B1 polyclonal antibody (Cat # PAB30589).
Lane 1: Human cell line RT-4
Lane 2: Human cell line U-251MG spImmunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human liver with CYP26B1 polyclonal antibody (Cat # PAB30589) shows cytoplasmic and membranous positivity in hepatocytes.Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with CYP26B1 polyclonal antibody (Cat # PAB30589) shows positivity in cytoplasm. Antibody staining is shown in green. -
Gene Info — CYP26B1
Entrez GeneID
56603Protein Accession#
Q9NR63Gene Name
CYP26B1
Gene Alias
CYP26A2, DKFZp686G0638, MGC129613, P450RAI-2
Gene Description
cytochrome P450, family 26, subfamily B, polypeptide 1
Omim ID
605207Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases that catalyze many reactions involved in drug metabolism and the synthesis of cholesterol, steroids and other lipids. The enzyme encoded by this gene is involved in the specific inactivation of all-trans-retinoic acid to hydroxylated forms, such as 4-oxo-, 4-OH-, and 18-OH-all-trans-retinoic acid. [provided by RefSeq
Other Designations
cytochrome P450 retinoid metabolizing protein|cytochrome P450, family 26, subfamily b, polypeptide 1|retinoic acid-metabolizing cytochrome
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com