YWHAB polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis with YWHAB polyclonal antibody (Cat # PAB30579).
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Western Blot
Western Blot analysis with YWHAB polyclonal antibody (Cat # PAB30579).
Lane 1: Human cell line RT-4
Lane 2: Human cell line U-251MG sp
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human colon with YWHAB polyclonal antibody (Cat # PAB30579) shows strong cytoplasmic positivity in glandular cells.
Immunofluorescence
Immunofluorescent staining of human cell line A-431 with YWHAB polyclonal antibody (Cat # PAB30579) shows positivity in cytoplasm. Antibody staining is shown in green.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human YWHAB.
Immunogen
Recombinant protein corresponding to amino acids 95-161 of human YWHAB.
Sequence
ICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKE
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis with YWHAB polyclonal antibody (Cat # PAB30579).
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)Western Blot
Western Blot analysis with YWHAB polyclonal antibody (Cat # PAB30579).
Lane 1: Human cell line RT-4
Lane 2: Human cell line U-251MG spImmunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human colon with YWHAB polyclonal antibody (Cat # PAB30579) shows strong cytoplasmic positivity in glandular cells.Immunofluorescence
Immunofluorescent staining of human cell line A-431 with YWHAB polyclonal antibody (Cat # PAB30579) shows positivity in cytoplasm. Antibody staining is shown in green. -
Gene Info — YWHAB
Entrez GeneID
7529Protein Accession#
P31946Gene Name
YWHAB
Gene Alias
GW128, HS1, KCIP-1
Gene Description
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide
Omim ID
601289Gene Ontology
HyperlinkGene Summary
This gene encodes a protein belonging to the 14-3-3 family of proteins, members of which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals. The encoded protein has been shown to interact with RAF1 and CDC25 phosphatases, suggesting that it may play a role in linking mitogenic signaling and the cell cycle machinery. Two transcript variants, which encode the same protein, have been identified for this gene. [provided by RefSeq
Other Designations
14-3-3 protein beta/alpha|OTTHUMP00000031075|OTTHUMP00000031076|brain protein 14-3-3, beta isoform|protein 1054|protein kinase C inhibitor protein-1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com