JPH1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western Blot analysis with JPH1 polyclonal antibody (Cat # PAB30567).
Lane 1: Human cell line RT-4
Lane 2: Human cell line U-251MG sp
Lane 3: Human plasma (IgG/HSA depleted)
Lane 4: Human liver tissue
Lane 5: Human tonsil tissue
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human skeletal muscle with JPH1 polyclonal antibody (Cat # PAB30567) shows strong cytoplasmic positivity in myocytes.
Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG with JPH1 polyclonal antibody (Cat # PAB30567) shows positivity in nucleus but excluded from the nucleoli. Antibody staining is shown in green.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human JPH1.
Immunogen
Recombinant protein corresponding to amino acids 387-512 of human JPH1.
Sequence
KADAADQAALAARQECDIARAVARELSPDFYQPGPDYVKQRFQEGVDAKENPEEKVPEKPPTPKESPHFYRKGTTPPRSPEASPKHSHSPASSPKPLKKQNPSSGARLNQDKRSVADEQVTAIVNK
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western Blot analysis with JPH1 polyclonal antibody (Cat # PAB30567).
Lane 1: Human cell line RT-4
Lane 2: Human cell line U-251MG sp
Lane 3: Human plasma (IgG/HSA depleted)
Lane 4: Human liver tissue
Lane 5: Human tonsil tissueImmunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human skeletal muscle with JPH1 polyclonal antibody (Cat # PAB30567) shows strong cytoplasmic positivity in myocytes.Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG with JPH1 polyclonal antibody (Cat # PAB30567) shows positivity in nucleus but excluded from the nucleoli. Antibody staining is shown in green. -
Gene Info — JPH1
Entrez GeneID
56704Protein Accession#
Q9HDC5Gene Name
JPH1
Gene Alias
DKFZp762L0313, JP-1, JP1
Gene Description
junctophilin 1
Omim ID
605266Gene Ontology
HyperlinkGene Summary
Junctional complexes between the plasma membrane and endoplasmic/sarcoplasmic reticulum are a common feature of all excitable cell types and mediate cross talk between cell surface and intracellular ion channels. The protein encoded by this gene is a component of junctional complexes and is composed of a C-terminal hydrophobic segment spanning the endoplasmic/sarcoplasmic reticulum membrane and a remaining cytoplasmic domain that shows specific affinity for the plasma membrane. This gene is a member of the junctophilin gene family. [provided by RefSeq
Other Designations
junctophilin type1|mitsugumin72
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com