DAXX polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human DAXX.
Immunogen
Recombinant protein corresponding to amino acids 481-626 of human DAXX.
Sequence
DEEEEAAAGKDGDKSPMSSLQISNEKNLEPGKQISRSSGEQQNKGRIVSPSLLSEEPLAPSSIDAESNGEQPEELTLEEESPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTVLENGAGMVSSTSFNGGVSPHNWGDSG
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis with DAXX polyclonal antibody (Cat # PAB30562).
Lane 1: Negative control (vector only transfected HEK293T lysate)
Lane 2: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human urinary bladder with DAXX polyclonal antibody (Cat # PAB30562) shows strong nuclear and cytoplasmic positivity in urothelial cells.Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG with DAXX polyclonal antibody (Cat # PAB30562) shows positivity in nucleus but excluded from the nucleoli. Antibody staining is shown in green. -
Gene Info — DAXX
Entrez GeneID
1616Protein Accession#
Q9UER7Gene Name
DAXX
Gene Alias
BING2, DAP6, EAP1, MGC126245, MGC126246
Gene Description
death-domain associated protein
Omim ID
603186Gene Ontology
HyperlinkGene Summary
This gene encodes a multifunctional protein that resides in multiple locations in the nucleus and in the cytoplasm. It interacts with a wide variety of proteins, such as apoptosis antigen Fas, centromere protein C, and transcription factor erythroblastosis virus E26 oncogene homolog 1. In the nucleus, the encoded protein functions as a potent transcription repressor that binds to sumoylated transcription factors. Its repression can be relieved by the sequestration of this protein into promyelocytic leukemia nuclear bodies or nucleoli. This protein also associates with centromeres in G2 phase. In the cytoplasm, the encoded protein may function to regulate apoptosis. The subcellular localization and function of this protein are modulated by post-translational modifications, including sumoylation, phosphorylation and polyubiquitination. Alternative splicing results in multiple transcript variants. [provided by RefSeq
Other Designations
CENP-C binding protein|ETS1-associated protein 1|Fas-binding protein|OTTHUMP00000029289|OTTHUMP00000029290|death-associated protein 6
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com