RING1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis with RING1 polyclonal antibody (Cat # PAB30560).
Lane 1: Negative control (vector only transfected HEK293T lysate)
Lane 2: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human nasopharynx with RING1 polyclonal antibody (Cat # PAB30560) shows strong nuclear and moderate cytoplasmic positivity in respiratory epithelial cells.
Immunofluorescence
Immunofluorescent staining of human cell line A-431 with RING1 polyclonal antibody (Cat # PAB30560) shows positivity in cytoplasm and nucleus but excluded from the nucleoli. Antibody staining is shown in green.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human RING1.
Immunogen
Recombinant protein corresponding to amino acids 281-392 of human RING1.
Sequence
TRYVKTTGNATVDHLSKYLALRIALERRQQQEAGEPGGPGGGASDTGGPDGCGGEGGGAGGGDGPEEPALPSLEGVSEKQYTIYIAPGGGAFTTLNGSLTLELVNEKFWKVS
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis with RING1 polyclonal antibody (Cat # PAB30560).
Lane 1: Negative control (vector only transfected HEK293T lysate)
Lane 2: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human nasopharynx with RING1 polyclonal antibody (Cat # PAB30560) shows strong nuclear and moderate cytoplasmic positivity in respiratory epithelial cells.Immunofluorescence
Immunofluorescent staining of human cell line A-431 with RING1 polyclonal antibody (Cat # PAB30560) shows positivity in cytoplasm and nucleus but excluded from the nucleoli. Antibody staining is shown in green. -
Gene Info — RING1
Entrez GeneID
6015Protein Accession#
Q06587Gene Name
RING1
Gene Alias
RING1A, RNF1
Gene Description
ring finger protein 1
Omim ID
602045Gene Ontology
HyperlinkGene Summary
This gene belongs to the RING finger family, members of which encode proteins characterized by a RING domain, a zinc-binding motif related to the zinc finger domain. The gene product can bind DNA and can act as a transcriptional repressor. It is associated with the multimeric polycomb group protein complex. The gene product interacts with the polycomb group proteins BMI1, EDR1, and CBX4, and colocalizes with these proteins in large nuclear domains. It interacts with the CBX4 protein via its glycine-rich C-terminal domain. The gene maps to the HLA class II region, where it is contiguous with the RING finger genes FABGL and HKE4. [provided by RefSeq
Other Designations
OTTHUMP00000029416
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com