KPNA6 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant human KPNA6.
Immunogen
Recombinant protein corresponding to human KPNA6.
Sequence
RRREEEGIQLRKQKREQQLFKRRNVELINEEAAMFDSLLMDSYVSSTTGESVITREMVEMLFSDDSDLQLATTQKFR
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis with KPNA6 polyclonal antibody (Cat # PAB30551)
Lane 1: Human cell line RT-4
Lane 2: Human cell line U-251MG spImmunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with KPNA6 polyclonal antibody (Cat # PAB30551) shows strong nuclear positivity in cells in tubules and cells in glomeruli.Immunofluorescence
Immunofluorescent staining of human cell line A-431 with KPNA6 polyclonal antibody (Cat # PAB30551) shows positivity in cytoplasm and nucleus but excluded from the nucleoli. Antibody staining is shown in green. -
Gene Info — KPNA6
Entrez GeneID
23633Protein Accession#
O60684Gene Name
KPNA6
Gene Alias
FLJ11249, IPOA7, KPNA7, MGC17918
Gene Description
karyopherin alpha 6 (importin alpha 7)
Omim ID
610563Gene Ontology
HyperlinkGene Summary
Nucleocytoplasmic transport, a signal- and energy-dependent process, takes place through nuclear pore complexes embedded in the nuclear envelope. The import of proteins containing a nuclear localization signal (NLS) requires the NLS import receptor, a heterodimer of importin alpha and beta subunits also known as karyopherins. Importin alpha binds the NLS-containing cargo in the cytoplasm and importin beta docks the complex at the cytoplasmic side of the nuclear pore complex. In the presence of nucleoside triphosphates and the small GTP binding protein Ran, the complex moves into the nuclear pore complex and the importin subunits dissociate. Importin alpha enters the nucleoplasm with its passenger protein and importin beta remains at the pore. The protein encoded by this gene is a member of the importin alpha family. [provided by RefSeq
Other Designations
OTTHUMP00000004532|importin alpha 7 subunit|importin-alpha-S2|karyopherin alpha 6
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com