Product Browser

Last updated: 2017/7/16

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ELMO2 polyclonal antibody

  • Catalog # : PAB30550
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant human ELMO2.
  • Immunogen:
  • Recombinant protein corresponding to human ELMO2.
  • Sequence:
  • CDGWSLPNPEYYTLRYADGPQLYITEQTRSDIKNGTILQLAISPSRAARQLMERTQSSNMETRLDAMKELAKLSAD
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
    Western Blot (1:100-1:250)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate) analysis with ELMO2 polyclonal antibody (Cat # PAB30550)
    Lane 1: Human cell line RT-4
    Lane 2: Human cell line U-251MG sp
    Lane 3: Human plasma (IgG/HSA depleted)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human smooth muscle with ELMO2 polyclonal antibody (Cat # PAB30550) shows cytoplasmic positivity in smooth muscle cells.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human cell line A549 with ELMO2 polyclonal antibody (Cat # PAB30550) shows positivity in cytoplasma. Antibody staining is shown in green.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Gene Name:
  • ELMO2
  • Gene Alias:
  • CED-12,CED12,ELMO-2,FLJ11656,KIAA1834
  • Gene Description:
  • engulfment and cell motility 2
  • Gene Summary:
  • The protein encoded by this gene interacts with the dedicator of cyto-kinesis 1 protein. Similarity to a C. elegans protein suggests that this protein may function in phagocytosis of apoptotic cells and in cell migration. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000031762,PH domain protein CED12A,ced-12 homolog 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook