Product Browser

Last updated: 2017/11/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

USP4 polyclonal antibody

  • Catalog # : PAB30547
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant human USP4.
  • Immunogen:
  • Recombinant protein corresponding to human USP4.
  • Sequence:
  • NMVVADVYNHRFHKIFQMDEGLNHIMPRDDIFVYEVCSTSVDGSECVTLPVYFRERKSRPSSTSSASALYGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPLPDEFGSSPL
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse, Rat
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
    Western Blot (1:100-1:250)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate) analysis with USP4 polyclonal antibody (Cat # PAB30547)
    Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
    Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human stomach with USP4 polyclonal antibody (Cat # PAB30547) shows strong cytoplasmic and membranous positivity in glandular cells.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human cell line A-431 with USP4 polyclonal antibody (Cat # PAB30547) shows positivity in plasma membrane and cytoplasma. Antibody staining is shown in green.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 7375
  • Gene Name:
  • USP4
  • Gene Alias:
  • MGC149848,MGC149849,UNP,Unph
  • Gene Description:
  • ubiquitin specific peptidase 4 (proto-oncogene)
  • Other Designations:
  • deubiquitinating enzyme 4,ubiquitin carboxyl-terminal esterase 4,ubiquitin carboxyl-terminal hydrolase 4,ubiquitin specific protease 4,ubiquitin specific protease 4 (proto-oncogene),ubiquitin thiolesterase 4,ubiquitin-specific processing protease 4
  • RSS
  • YouTube
  • Linkedin
  • Facebook