CTNND1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot (Cell lysate) analysis with CTNND1 polyclonal antibody (Cat # PAB30541)
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human gallbladder with CTNND1 polyclonal antibody (Cat # PAB30541) shows membranous positivity in glandular cells.
Immunofluorescence
Immunofluorescent staining of human cell line A-431 with CTNND1 polyclonal antibody (Cat # PAB30541) shows positivity in plasma membrane. Antibody staining is shown in green.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant human CTNND1.
Immunogen
Recombinant protein corresponding to human CTNND1.
Sequence
SVKEQEAQFEKLTRALEEERRHVSAQLERVRVSPQDANPLMANGTLTRRHQNGRFVGDADLERQKFSDLKLNGPQDHSHLLYSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTR
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot (Cell lysate) analysis with CTNND1 polyclonal antibody (Cat # PAB30541)
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human gallbladder with CTNND1 polyclonal antibody (Cat # PAB30541) shows membranous positivity in glandular cells.Immunofluorescence
Immunofluorescent staining of human cell line A-431 with CTNND1 polyclonal antibody (Cat # PAB30541) shows positivity in plasma membrane. Antibody staining is shown in green. -
Gene Info — CTNND1
Entrez GeneID
1500Protein Accession#
O60716Gene Name
CTNND1
Gene Alias
CAS, CTNND, KIAA0384, P120CAS, P120CTN, p120
Gene Description
catenin (cadherin-associated protein), delta 1
Omim ID
601045Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the Armadillo protein family, which function in adhesion between cells and signal transduction. Multiple translation initiation codons and althernative splicing result in many different isoforms being translated. Not all of the full-length natures of the described transcript variants have been determined. [provided by RefSeq
Other Designations
catenin, delta 1
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com