WHSC1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot (Cell lysate) analysis with WHSC1 polyclonal antibody (Cat # PAB30540)
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human oral mucosa with WHSC1 polyclonal antibody (Cat # PAB30540) shows strong nuclear positivity in squamous epithelial cells.
Immunofluorescence
Immunofluorescent staining of human cell line A-431 with WHSC1 polyclonal antibody (Cat # PAB30540) shows positivity in nucleus but excluded from the nucleoli. Antibody staining is shown in green.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant human WHSC1.
Immunogen
Recombinant protein corresponding to human WHSC1.
Sequence
SANGKTPSCEVNRECSVFLSKAQLSSSLQEGVMQKFNGHDALPFIPADKLKDLTSRVFNGEPGAHDAKLRFESQEMKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGD
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot (Cell lysate) analysis with WHSC1 polyclonal antibody (Cat # PAB30540)
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human oral mucosa with WHSC1 polyclonal antibody (Cat # PAB30540) shows strong nuclear positivity in squamous epithelial cells.Immunofluorescence
Immunofluorescent staining of human cell line A-431 with WHSC1 polyclonal antibody (Cat # PAB30540) shows positivity in nucleus but excluded from the nucleoli. Antibody staining is shown in green. -
Gene Info — WHSC1
Entrez GeneID
7468Protein Accession#
O96028Gene Name
WHSC1
Gene Alias
FLJ23286, KIAA1090, MGC176638, MMSET, NSD2, REIIBP, TRX5, WHS
Gene Description
Wolf-Hirschhorn syndrome candidate 1
Omim ID
602952Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that contains four domains present in other developmental proteins: a PWWP domain, an HMG box, a SET domain, and a PHD-type zinc finger. It is expressed ubiquitously in early development. Wolf-Hirschhorn syndrome (WHS) is a malformation syndrome associated with a hemizygous deletion of the distal short arm of chromosome 4. This gene maps to the 165 kb WHS critical region and has also been involved in the chromosomal translocation t(4;14)(p16.3;q32.3) in multiple myelomas. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. Some transcript variants are nonsense-mediated mRNA (NMD) decay candidates, hence not represented as reference sequences. [provided by RefSeq
Other Designations
IL5 promoter REII region-binding protein|OTTHUMP00000149955|OTTHUMP00000159146|Wolf-Hirschhorn syndrome candidate 1 protein|multiple myeloma SET domain containing protein type III|trithorax/ash1-related protein 5
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com