Product Browser

Last updated: 2017/9/17

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

WHSC1 polyclonal antibody

  • Catalog # : PAB30540
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant human WHSC1.
  • Immunogen:
  • Recombinant protein corresponding to human WHSC1.
  • Sequence:
  • SANGKTPSCEVNRECSVFLSKAQLSSSLQEGVMQKFNGHDALPFIPADKLKDLTSRVFNGEPGAHDAKLRFESQEMKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGD
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse, Rat
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
    Western Blot (1:100-1:250)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate) analysis with WHSC1 polyclonal antibody (Cat # PAB30540)
    Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
    Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human oral mucosa with WHSC1 polyclonal antibody (Cat # PAB30540) shows strong nuclear positivity in squamous epithelial cells.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human cell line A-431 with WHSC1 polyclonal antibody (Cat # PAB30540) shows positivity in nucleus but excluded from the nucleoli. Antibody staining is shown in green.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 7468
  • Gene Name:
  • WHSC1
  • Gene Alias:
  • FLJ23286,KIAA1090,MGC176638,MMSET,NSD2,REIIBP,TRX5,WHS
  • Gene Description:
  • Wolf-Hirschhorn syndrome candidate 1
  • Gene Summary:
  • This gene encodes a protein that contains four domains present in other developmental proteins: a PWWP domain, an HMG box, a SET domain, and a PHD-type zinc finger. It is expressed ubiquitously in early development. Wolf-Hirschhorn syndrome (WHS) is a malformation syndrome associated with a hemizygous deletion of the distal short arm of chromosome 4. This gene maps to the 165 kb WHS critical region and has also been involved in the chromosomal translocation t(4;14)(p16.3;q32.3) in multiple myelomas. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. Some transcript variants are nonsense-mediated mRNA (NMD) decay candidates, hence not represented as reference sequences. [provided by RefSeq
  • Other Designations:
  • IL5 promoter REII region-binding protein,OTTHUMP00000149955,OTTHUMP00000159146,Wolf-Hirschhorn syndrome candidate 1 protein,multiple myeloma SET domain containing protein type III,trithorax/ash1-related protein 5
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook