MAPKAPK5 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot (Cell lysate) analysis with MAPKAPK5 polyclonal antibody (Cat # PAB30537)
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human stomach with MAPKAPK5 polyclonal antibody (Cat # PAB30537) shows strong nuclear positivity in glandular cells.
Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG with MAPKAPK5 polyclonal antibody (Cat # PAB30537) shows positivity in cytoplasm and nucleus but excluded from the nucleoli. Antibody staining is shown in green.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant human MAPKAPK5.
Immunogen
Recombinant protein corresponding to human MAPKAPK5.
Sequence
PLHSVNNPILRKRKLLGTKPKDSVYIHDHENGAEDSNVALEKLRDVIAQCILPQAGKGENEDEKLNEVMQEAWKYNRECKLLRDTLQSFSWNGRGFTDKVDRLKLAEIVKQVIEEQTTSH
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot (Cell lysate) analysis with MAPKAPK5 polyclonal antibody (Cat # PAB30537)
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human stomach with MAPKAPK5 polyclonal antibody (Cat # PAB30537) shows strong nuclear positivity in glandular cells.Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG with MAPKAPK5 polyclonal antibody (Cat # PAB30537) shows positivity in cytoplasm and nucleus but excluded from the nucleoli. Antibody staining is shown in green. -
Gene Info — MAPKAPK5
Entrez GeneID
8550Protein Accession#
Q8IW41Gene Name
MAPKAPK5
Gene Alias
PRAK
Gene Description
mitogen-activated protein kinase-activated protein kinase 5
Omim ID
606723Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the serine/threonine kinase family. In response to cellular stress and proinflammatory cytokines, this kinase is activated through its phosphorylation by MAP kinases including MAPK1/ERK, MAPK14/p38-alpha, and MAPK11/p38-beta. In vitro, this kinase phosphorylates heat shock protein HSP27 at its physiologically relevant sites. Two alternately spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq
Other Designations
p38-regulated/activated protein kinase
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com