NFKB1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant human NFKB1.
Immunogen
Recombinant protein corresponding to human NFKB1.
Sequence
GTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGEVTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAV
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot (Cell lysate) analysis of human cell line RT-4 with NFKB1 polyclonal antibody (Cat # PAB30533).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lymph node with NFKB1 polyclonal antibody (Cat # PAB30533) shows strong cytoplasmic positivity.Immunofluorescence
Immunofluorescent staining of human cell line A-431 with NFKB1 polyclonal antibody (Cat # PAB30533) shows positivity in cytoplasm and nucleus but excluded from the nucleoli. Antibody staining is shown in green. -
Gene Info — NFKB1
Entrez GeneID
4790Protein Accession#
P19838Gene Name
NFKB1
Gene Alias
DKFZp686C01211, EBP-1, KBF1, MGC54151, NF-kappa-B, NFKB-p105, NFKB-p50, p105, p50
Gene Description
nuclear factor of kappa light polypeptide gene enhancer in B-cells 1
Omim ID
164011Gene Ontology
HyperlinkGene Summary
This gene encodes a 105 kD protein which can undergo cotranslational processing by the 26S proteasome to produce a 50 kD protein. The 105 kD protein is a Rel protein-specific transcription inhibitor and the 50 kD protein is a DNA binding subunit of the NF-kappa-B (NFKB) protein complex. NFKB is a transcription regulator that is activated by various intra- and extra-cellular stimuli such as cytokines, oxidant-free radicals, ultraviolet irradiation, and bacterial or viral products. Activated NFKB translocates into the nucleus and stimulates the expression of genes involved in a wide variety of biological functions. Inappropriate activation of NFKB has been associated with a number of inflammatory diseases while persistent inhibition of NFKB leads to inappropriate immune cell development or delayed cell growth. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
DNA binding factor KBF1|NF-kappabeta|nuclear factor NF-kappa-B p50 subunit|nuclear factor kappa-B DNA binding subunit|nuclear factor kappa-B, subunit 1
-
Interactome
-
Pathway
-
Disease
- Abortion
- Acute Lung Injury
- Adenocarcinoma
- Alcoholism
- Alzheimer disease
- Arthritis
- Asthma
- Atherosclerosis
- Behcet Syndrome
+ View More Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com