TRAF3 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot (Cell lysate) analysis with TRAF3 polyclonal antibody (Cat # PAB30523)
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human pancreas with TRAF3 polyclonal antibody (Cat # PAB30523) shows strong cytoplasmic positivity in granular pattern in exocrine glandular cells.
Immunofluorescence
Immunofluorescent staining of human cell line A-431 with TRAF3 polyclonal antibody (Cat # PAB30523) shows positivity in nucleus but excluded from the nucleoli. Antibody staining is shown in green.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant human TRAF3.
Immunogen
Recombinant protein corresponding to human TRAF3.
Sequence
SSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLTLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVV
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot (Cell lysate) analysis with TRAF3 polyclonal antibody (Cat # PAB30523)
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human pancreas with TRAF3 polyclonal antibody (Cat # PAB30523) shows strong cytoplasmic positivity in granular pattern in exocrine glandular cells.Immunofluorescence
Immunofluorescent staining of human cell line A-431 with TRAF3 polyclonal antibody (Cat # PAB30523) shows positivity in nucleus but excluded from the nucleoli. Antibody staining is shown in green. -
Gene Info — TRAF3
Entrez GeneID
7187Protein Accession#
Q13114Gene Name
TRAF3
Gene Alias
CAP-1, CD40bp, CRAF1, LAP1
Gene Description
TNF receptor-associated factor 3
Omim ID
601896Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins associate with, and mediate the signal transduction from, members of the TNF receptor (TNFR) superfamily. This protein participates in the signal transduction of CD40, a TNFR family member important for the activation of the immune response. This protein is found to be a critical component of the lymphotoxin-beta receptor (LTbetaR) signaling complex, which induces NF-kappaB activation and cell death initiated by LTbeta ligation. Epstein-Barr virus encoded latent infection membrane protein-1 (LMP1) can interact with this and several other members of the TRAF family, which may be essential for the oncogenic effects of LMP1. Three alternatively spliced transcript variants encoding two distinct isoforms have been reported. [provided by RefSeq
Other Designations
CD40 associated protein 1|CD40 binding protein|CD40 receptor associated factor 1|LMP1 associated protein
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com