Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TAC1 polyclonal antibody

  • Catalog # : PAB30483
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombinant human TAC1.
  • Immunogen:
  • Recombinant protein corresponding to human TAC1.
  • Sequence:
  • WSDWYDSDQIKEELPEPFEHLLQRIARRPKPQQFFGLMGKRDADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLMGKRALNSVAYERSAMQNYERRR
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human duodenum with TAC1 polyclonal antibody (Cat # PAB30483) shows strong cytoplasmic positivity in Brunner's glands at 1:50-1:200 dilution.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 6863
  • Gene Name:
  • TAC1
  • Gene Alias:
  • Hs.2563,NK2,NKNA,NPK,TAC2
  • Gene Description:
  • tachykinin, precursor 1
  • Gene Summary:
  • This gene encodes four products of the tachykinin peptide hormone family, substance P and neurokinin A, as well as the related peptides, neuropeptide K and neuropeptide gamma. These hormones are thought to function as neurotransmitters which interact with nerve receptors and smooth muscle cells. They are known to induce behavioral responses and function as vasodilators and secretagogues. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • neurokinin 1,neurokinin 2,neurokinin A,neurokinin alpha,neuromedin L,neuropeptide K,neuropeptide gamma,substance K,substance P,tachykinin 1,tachykinin 2,tachykinin, precursor 1 (substance K, substance P, neurokinin 1, neurokinin 2, neuromedin L, neurokini
  • RSS
  • YouTube
  • Linkedin
  • Facebook