Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ITGA2 polyclonal antibody

  • Catalog # : PAB30304
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombinant human ITGA2.
  • Immunogen:
  • Recombinant protein corresponding to amino acids 770-858 of human ITGA2.
  • Sequence:
  • ALEAYSETAKVFSIPFHKDCGEDGLCISDLVLDVRQIPAAQEQPFIVSNQNKRLTFSVTLKNKRESAYNTGIVVDFSENLFFASFSLPV
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20 - 1:50)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C for short term storage. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human uterus with ITGA2 polyclonal antibody (Cat # PAB30304) shows strong cytoplasmic and membranous positivity in glandular cells.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 3673
  • Gene Name:
  • ITGA2
  • Gene Alias:
  • BR,CD49B,GPIa,VLA-2,VLAA2
  • Gene Description:
  • integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor)
  • Gene Summary:
  • This gene product belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane glycoproteins composed of a distinct alpha chain and a common beta chain. They are found on a wide variety of cell types including, T cells, fibroblasts and platelets. Integrins are involved in cell adhesion and also participate in cell-surface mediated signalling. [provided by RefSeq
  • Other Designations:
  • integrin alpha 2,platelet antigen Br,platelet glycoprotein GPIa,platelet glycoprotein Ia,very late activation protein 2 receptor, alpha-2 subunit
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook