Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ENPP1 polyclonal antibody

  • Catalog # : PAB30301
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombinant human ENPP1.
  • Immunogen:
  • Recombinant protein corresponding to amino acids 96-149 of human ENPP1.
  • Sequence:
  • GLKPSCAKEVKSCKGRCFERTFGNCRCDAACVELGNCCLDYQETCIEPEHIWTC
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20 - 1:50)
    Western Blot (1:100 - 1:250)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C for short term storage. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot
  • Western Blot
  • Western Blot analysis with ENPP1 polyclonal antibody (Cat # PAB30301).
    Lane 1: Human cell line RT-4
    Lane 2: Human cell line U-251MG
    Lane 3: Human plasma
    Lane 4: Human liver tissue
    Lane 5: Human tonsil tissue
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human placenta with ENPP1 polyclonal antibody (Cat # PAB30301) shows cytoplasmic positivity in stromal cells.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 5167
  • Gene Name:
  • ENPP1
  • Gene Alias:
  • M6S1,NPP1,NPPS,PC-1,PCA1,PDNP1
  • Gene Description:
  • ectonucleotide pyrophosphatase/phosphodiesterase 1
  • Gene Summary:
  • This gene is a member of the ecto-nucleotide pyrophosphatase/phosphodiesterase (ENPP) family. The encoded protein is a type II transmembrane glycoprotein comprising two identical disulfide-bonded subunits. This protein has broad specificity and cleaves a variety of substrates, including phosphodiester bonds of nucleotides and nucleotide sugars and pyrophosphate bonds of nucleotides and nucleotide sugars. This protein may function to hydrolyze nucleoside 5' triphosphates to their corresponding monophosphates and may also hydrolyze diadenosine polyphosphates. Mutations in this gene have been associated with 'idiopathic' infantile arterial calcification, ossification of the posterior longitudinal ligament of the spine (OPLL), and insulin resistance. [provided by RefSeq
  • Other Designations:
  • Ly-41 antigen,OTTHUMP00000043194,alkaline phosphodiesterase 1,membrane component, chromosome 6, surface marker 1,phosphodiesterase I/nucleotide pyrophosphatase 1,plasma-cell membrane glycoprotein 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook