CD1E polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Rabbit polyclonal antibody raised against partial recombinant human CD1E.
Immunogen
Recombinant protein corresponding to amino acids 79-147 of human CD1E.
Sequence
PWSHGNFSKQELKNLQSLFQLYFHSFIRIVQASAGQFQLEYPFEIQILAGCRMNAPQIFLNMAYQGSDF
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20 - 1:50)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis with CD1E polyclonal antibody (Cat # PAB30295).
Lane 1: Human cell line RT-4
Lane 2: Human cell line U-251MG spImmunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human heart muscle with CD1E polyclonal antibody (Cat # PAB30295) shows moderate to strong cytoplasmic positivity in myocytes.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human liver cancer with CD1E polyclonal antibody (Cat # PAB30295) shows weak cytoplasmic positivity in tumor cells.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lymph node with CD1E polyclonal antibody (Cat # PAB30295) shows moderate cytoplasmic positivity in subset of non-germinal center cells. -
Gene Info — CD1E
Entrez GeneID
913Protein Accession#
P15812Gene Name
CD1E
Gene Alias
CD1A, R2
Gene Description
CD1e molecule
Omim ID
188411Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes within Golgi compartments, endosomes, and lysosomes, and is cleaved into a stable soluble form. The soluble form is required for the intracellular processing of some glycolipids into a form that can be presented by other CD1 family members. Several alternatively spliced transcript variants encoding different isoforms have been described. Additional transcript variants have been found; however, their biological validity has not been determined. [provided by RefSeq
Other Designations
CD1E antigen|CD1E antigen, e polypeptide|OTTHUMP00000018910|OTTHUMP00000018913|OTTHUMP00000018914|OTTHUMP00000018915|OTTHUMP00000018916|OTTHUMP00000018920|T-cell surface glycoprotein CD1e|differentiation antigen CD1-alpha-3|leukocyte differentiation antig
-
Interactomes
-
Pathways
-
Diseases
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com