Product Browser

Last updated: 2017/12/10

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CRTAM polyclonal antibody

  • Catalog # : PAB30286
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombinant human CRTAM.
  • Immunogen:
  • Recombinant protein corresponding to amino acids 153-241 of human CRTAM.
  • Sequence:
  • TWLLGNSMEVSGGTLHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSLSSQDPQQP
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000 - 1:2500)
    Western Blot (1:250 - 1:500)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C for short term storage. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western Blot analysis with CRTAM polyclonal antibody (Cat # PAB30286).
    Lane 1: Human cell line RT-4
    Lane 2: Human cell line U-251MG sp
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human duodenum with CRTAM polyclonal antibody (Cat # PAB30286) shows strong cytoplasmic positivity in glandular cells.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Gene Name:
  • CRTAM
  • Gene Alias:
  • -
  • Gene Description:
  • cytotoxic and regulatory T cell molecule
  • Gene Summary:
  • The CRTAM gene is upregulated in CD4 (see MIM 186940)-positive and CD8 (see CD8A; MIM 186910)-positive T cells and encodes a type I transmembrane protein with V and C1-like Ig domains (Yeh et al., 2008 [PubMed 18329370]).[supplied by OMIM
  • Other Designations:
  • class I MHC restricted T cell associated molecule,class-I MHC-restricted T cell associated molecule
  • RSS
  • YouTube
  • Linkedin
  • Facebook