CR1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western Blot analysis with CR1 polyclonal antibody (Cat # PAB30270).
Lane 1: Human cell line RT-4
Lane 2: Human cell line U-251MG sp
Lane 3: Human plasma (IgG/HSA depleted)
Lane 4: Human liver tissue
Lane 5: Human tonsil tissue
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human tonsil with CR1 polyclonal antibody (Cat # PAB30270) shows distinct reticular positivity in germinal center.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human CR1.
Immunogen
Recombinant protein corresponding to amino acids 278-334 of human CR1.
Sequence
VKCQALNKWEPELPSCSRVCQPPPDVLHAERTQRDKDNFSPGQEVFYSCEPGYDLRG
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500)
Western Blot (1:250 - 1:500)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western Blot analysis with CR1 polyclonal antibody (Cat # PAB30270).
Lane 1: Human cell line RT-4
Lane 2: Human cell line U-251MG sp
Lane 3: Human plasma (IgG/HSA depleted)
Lane 4: Human liver tissue
Lane 5: Human tonsil tissueImmunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human tonsil with CR1 polyclonal antibody (Cat # PAB30270) shows distinct reticular positivity in germinal center. -
Gene Info — CR1
Entrez GeneID
1378Protein Accession#
P17927Gene Name
CR1
Gene Alias
C3BR, CD35, KN
Gene Description
complement component (3b/4b) receptor 1 (Knops blood group)
Gene Ontology
HyperlinkGene Summary
This gene is a member of the receptors of complement activation (RCA) family and is located in the 'cluster RCA' region of chromosome 1. The gene encodes a monomeric single-pass type I membrane glycoprotein found on erythrocytes, leukocytes, glomerular podocytes, and splenic follicular dendritic cells. The Knops blood group system is a system of antigens located on this protein. The protein mediates cellular binding to particles and immune complexes that have activated complement. Decreases in expression of this protein and/or mutations in its gene have been associated with gallbladder carcinomas, mesangiocapillary glomerulonephritis, systemic lupus erythematosus and sarcoidosis. Mutations in this gene have also been associated with a reduction in Plasmodium falciparum rosetting, conferring protection against severe malaria. Alternate allele-specific splice variants, encoding different isoforms, have been characterized. Additional allele specific isoforms, including a secreted form, have been described but have not been fully characterized. [provided by RefSeq
Other Designations
C3-binding protein|C3b/C4b receptor|CD35 antigen|Knops blood group antigen|complement component receptor 1|complement receptor 1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com