Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CLU polyclonal antibody

  • Catalog # : PAB30261
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant human CLU.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human CLU.
  • Sequence:
  • SSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNS
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
    Western Blot (1:250-1:500)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • Western Blot (Cell lysate) analysis with CLU polyclonal antibody (Cat # PAB30261) at 1:250 - 1:500 dilution
    Lane 1: Human cell line RT-4
    Lane 2: Human cell line EFO-21
    Lane 3: Human cell line U-138MG (DSMZ)
    Lane 4: Human liver tissue
    Lane 5: Human tonsil tissue
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human tonsil with CLU polyclonal antibody (Cat # PAB30261) shows strong positivity in squamous epithelial cells at 1:200 - 1:500 dilution.
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 1191
  • Gene Name:
  • CLU
  • Gene Alias:
  • AAG4,APOJ,CLI,KUB1,MGC24903,SGP-2,SGP2,SP-40,TRPM-2,TRPM2
  • Gene Description:
  • clusterin
  • Other Designations:
  • OTTHUMP00000128311,aging-associated protein 4,apolipoprotein J,clusterin (complement lysis inhibitor, SP-40,40, sulfated glycoprotein 2, testosterone-repressed prostate message 2, apolipoprotein J),complement lysis inhibitor,complement-associated protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook