Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HSPB1 polyclonal antibody

  • Catalog # : PAB30258
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant human HSPB1.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human HSPB1.
  • Sequence:
  • EEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSS
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
    Western Blot (1:250-1:500)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • Western Blot (Cell lysate) analysis with HSPB1 polyclonal antibody (Cat # PAB30258) at 1:250 - 1:500 dilution
    Lane 1: Human cell line RT-4
    Lane 2: Human cell line EFO-21
    Lane 3: Human cell line A-431
    Lane 4: Human liver tissue
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human smooth muscle with HSPB1 polyclonal antibody (Cat # PAB30258) shows strong cytoplasmic positivity in smooth muscle cells at 1:50 - 1:200 dilution.
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 3315
  • Gene Name:
  • HSPB1
  • Gene Alias:
  • CMT2F,DKFZp586P1322,HMN2B,HS.76067,HSP27,HSP28,Hsp25,SRP27
  • Gene Description:
  • heat shock 27kDa protein 1
  • Gene Summary:
  • The protein encoded by this gene is induced by environmental stress and developmental changes. The encoded protein is involved in stress resistance and actin organization and translocates from the cytoplasm to the nucleus upon stress induction. Defects in this gene are a cause of Charcot-Marie-Tooth disease type 2F (CMT2F) and distal hereditary motor neuropathy (dHMN). [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000024846,estrogen-regulated 24 kDa protein,heat shock 27kD protein 1,heat shock protein beta-1,stress-responsive protein 27
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook