MSR1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot (Cell lysate) analysis with MSR1 polyclonal antibody (Cat # PAB30252) at 1:100 - 1:250 dilution
Lane 1: Negative control (vector only transfected HEK293T lysate)
Lane 2: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lung with MSR1 polyclonal antibody (Cat # PAB30252) shows strong cytoplasmic positivity in macrophages at 1:50 - 1:200 dilution.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant human MSR1.
Immunogen
Recombinant protein corresponding to amino acids of human MSR1.
Sequence
KWETKNCSVSSTNANDITQSLTGKGNDSEEEMRFQEVFMEHMSNMEKRIQHILDMEANLMDTEHFQNFSMTTDQRFNDILLQLSTLFSSVQGHGNAIDEISKSLISLNTTLLDLQLNIENL
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot (Cell lysate) analysis with MSR1 polyclonal antibody (Cat # PAB30252) at 1:100 - 1:250 dilution
Lane 1: Negative control (vector only transfected HEK293T lysate)
Lane 2: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lung with MSR1 polyclonal antibody (Cat # PAB30252) shows strong cytoplasmic positivity in macrophages at 1:50 - 1:200 dilution. -
Gene Info — MSR1
Entrez GeneID
4481Protein Accession#
P21757Gene Name
MSR1
Gene Alias
CD204, SCARA1, SR-A, phSR1, phSR2
Gene Description
macrophage scavenger receptor 1
Gene Ontology
HyperlinkGene Summary
This gene encodes the class A macrophage scavenger receptors, which include three different types (1, 2, 3) generated by alternative splicing of this gene. These receptors or isoforms are macrophage-specific trimeric integral membrane glycoproteins and have been implicated in many macrophage-associated physiological and pathological processes including atherosclerosis, Alzheimer's disease, and host defense. The isoforms type 1 and type 2 are functional receptors and are able to mediate the endocytosis of modified low density lipoproteins (LDLs). The isoform type 3 does not internalize modified LDL (acetyl-LDL) despite having the domain shown to mediate this function in the types 1 and 2 isoforms. It has an altered intracellular processing and is trapped within the endoplasmic reticulum, making it unable to perform endocytosis. The isoform type 3 can inhibit the function of isoforms type 1 and type 2 when co-expressed, indicating a dominant negative effect and suggesting a mechanism for regulation of scavenger receptor activity in macrophages. [provided by RefSeq
Other Designations
OTTHUMP00000120049|OTTHUMP00000120050|macrophage acetylated LDL receptor I and II|macrophage scavenger receptor type III|scavenger receptor class A, member 1
-
Interactome
-
Disease
-
Publication Reference
-
Co-targeting FAK and Gli1 inhibits the tumor-associated macrophages-released CCL22-mediated esophageal squamous cell carcinoma malignancy.
Jie Chen, Yanmeng Zhu, Di Zhao, Lingyuan Zhang, Jing Zhang, Yuanfan Xiao, Qingnan Wu, Yan Wang, Qimin Zhan.
MedComm 2023 Oct; 4(6):e381.
Application：IHC, Human, KYSE410, KYSE510 (esophageal squamous cell carcinoma, ESCC cells).
-
Co-targeting FAK and Gli1 inhibits the tumor-associated macrophages-released CCL22-mediated esophageal squamous cell carcinoma malignancy.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com