Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SERPINA1 polyclonal antibody

  • Catalog # : PAB30249
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against recombinant human SERPINA1.
  • Immunogen:
  • Recombinant protein corresponding to amino acids of human SERPINA1.
  • Sequence:
  • HDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYGAPHR
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:2500-1:5000)
    Western Blot (1:250-1:500)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate) analysis with SERPINA1 polyclonal antibody (Cat # PAB30249) at 1:250 - 1:500 dilution
    Lane 1: Human cell line RT-4
    Lane 2: Human cell line U-251MG sp
    Lane 3: Human cell line A-431
    Lane 4: Human liver tissue
    Lane 5: Human tonsil tissue
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with SERPINA1 polyclonal antibody (Cat # PAB30249) shows moderate extra-cellular positivity in tubule cells and positivity of plasma in blood vesse at 1:200 - 1:500 dilution.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 5265
  • Gene Name:
  • SERPINA1
  • Gene Alias:
  • A1A,A1AT,AAT,MGC23330,MGC9222,PI,PI1,PRO2275
  • Gene Description:
  • serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1
  • Gene Summary:
  • The protein encoded by this gene is secreted and is a serine protease inhibitor whose targets include elastase, plasmin, thrombin, trypsin, chymotrypsin, and plasminogen activator. Defects in this gene can cause emphysema or liver disease. Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
  • Other Designations:
  • protease inhibitor 1 (anti-elastase), alpha-1-antitrypsin,serine (or cysteine) proteinase inhibitor, clade A, member 1,serine proteinase inhibitor, clade A, member 1
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook