MCM5 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot (Cell lysate) analysis with MCM5 polyclonal antibody (Cat # PAB30248) at 1:100 - 1:250 dilution
Lane 1: Negative control (vector only transfected HEK293T lysate)
Lane 2: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis with MCM5 polyclonal antibody (Cat # PAB30248) shows strong nuclear positivity in cells in seminiferus ducts at 1:500 - 1:1000 dilution.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant human MCM5.
Immunogen
Recombinant protein corresponding to amino acids of human MCM5.
Sequence
NRYIIMRSGARQHERDSDRRSSIPITVRQLEAIVRIAEALSKMKLQPFATEADVEEALRLFQVSTLDAALSGTLSGVEGFTSQEDQEMLSRIEKQLKRRFAIGSQVSEHSIIKDFTKQKYPEHAIHKVLQLMLRRGEIQHRMQRKVLY
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot (Cell lysate) analysis with MCM5 polyclonal antibody (Cat # PAB30248) at 1:100 - 1:250 dilution
Lane 1: Negative control (vector only transfected HEK293T lysate)
Lane 2: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis with MCM5 polyclonal antibody (Cat # PAB30248) shows strong nuclear positivity in cells in seminiferus ducts at 1:500 - 1:1000 dilution. -
Gene Info — MCM5
Entrez GeneID
4174Protein Accession#
P33992Gene Name
MCM5
Gene Alias
CDC46, MGC5315, P1-CDC46
Gene Description
minichromosome maintenance complex component 5
Omim ID
602696Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is structurally very similar to the CDC46 protein from S. cerevisiae, a protein involved in the initiation of DNA replication. The encoded protein is a member of the MCM family of chromatin-binding proteins and can interact with at least two other members of this family. The encoded protein is upregulated in the transition from the G0 to G1/S phase of the cell cycle and may actively participate in cell cycle regulation. [provided by RefSeq
Other Designations
DNA replication licensing factor|MCM5 minichromosome maintenance deficient 5, cell division cycle 46|minichromosome maintenance deficient 5 (cell division cycle 46)
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com