BID polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot (Cell lysate) analysis with BID polyclonal antibody (Cat # PAB30245) at 1:100 - 1:250 dilution
Lane 1: Human cell line RT-4
Lane 2: Human cell line EFO-21
Lane 3: Human cell line A-431
Lane 4: Human liver tissue
Lane 5: Human tonsil tissue
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human spleen with BID polyclonal antibody (Cat # PAB30245) shows strong cytoplasmic positivity in cells in red pulp at 1:1000 - 1:2500 dilution.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant human BID.
Immunogen
Recombinant protein corresponding to amino acids of human BID.
Sequence
VNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLAR
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot (Cell lysate) analysis with BID polyclonal antibody (Cat # PAB30245) at 1:100 - 1:250 dilution
Lane 1: Human cell line RT-4
Lane 2: Human cell line EFO-21
Lane 3: Human cell line A-431
Lane 4: Human liver tissue
Lane 5: Human tonsil tissueImmunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human spleen with BID polyclonal antibody (Cat # PAB30245) shows strong cytoplasmic positivity in cells in red pulp at 1:1000 - 1:2500 dilution. -
Gene Info — BID
Entrez GeneID
637Protein Accession#
P55957Gene Name
BID
Gene Alias
FP497, MGC15319, MGC42355
Gene Description
BH3 interacting domain death agonist
Omim ID
601997Gene Ontology
HyperlinkGene Summary
This gene encodes a death agonist that heterodimerizes with either agonist BAX or antagonist BCL2. The encoded protein is a member of the BCL-2 family of cell death regulators. It is a mediator of mitochondrial damage induced by caspase-8 (CASP8); CASP8 cleaves this encoded protein, and the COOH-terminal part translocates to mitochondria where it triggers cytochrome c release. Multiple alternatively spliced transcript variants have been found, but the full-length nature of some variants has not been defined. [provided by RefSeq
Other Designations
BH3-interacting domain death agonist|BID isoform ES(1b)|BID isoform L(2)|BID isoform Si6|Human BID coding sequence|OTTHUMP00000196197|apoptic death agonist|desmocollin type 4
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com