Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PNMA2 polyclonal antibody

  • Catalog # : PAB30227
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombinant human PNMA2.
  • Immunogen:
  • Recombinant protein corresponding to amino acids 58 - 206 of human PNMA2.
  • Sequence:
  • KQENANAVLLELLEDTDVSAIPSEVQGKGGVWKVIFKTPNQDTEFLERLNLFLEKEGQTVSGMFRALGQEGVSPATVPCISPELLAHLLGQAMAHAPQPLLPMRYRKLRVFSGSAVPAPEEESFEVWLEQATEIVKEWPVTEAEKKRWL
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500)
    Western Blot (1:100 - 1:250)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western blot analysis of Lane 1: Negative control (vector only transfected HEK293T lysate), Lane 2: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells) with PNMA2 polyclonal antibody (Cat # PAB30227).
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex shows moderate cytoplasmic and nucleolar positivity in neuronal cells with PNMA2 polyclonal antibody (Cat # PAB30227).
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Gene Name:
  • PNMA2
  • Gene Alias:
  • KIAA0883,MA2,MM2,RGAG2
  • Gene Description:
  • paraneoplastic antigen MA2
  • Other Designations:
  • onconeuronal antigen MA2,paraneoplastic neuronal antigen,retrotransposon gag domain containing 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook