LAMC1 polyclonal antibody

Catalog # PAB30226

Size

Price

Stock

Quantity

Size:100 uL
Price: USD $ 428.00
Stock:
order now, ship in 5 days
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

Western blot analysis of Lane 1: NIH/3T3 cell lysate and Lane 2: NBT-II cell lysate with LAMC1 polyclonal antibody (Cat # PAB30226).

Western Blot
Application

Western Blot

Western blot analysis of Lane 1: RT-4 cell line, Lane 2: U-251MG sp cell line, Lane 3: A-431 cell line, Lane 4: human liver tissue, and Lane 5: human tonsil tissue with LAMC1 polyclonal antibody (Cat # PAB30226).

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Application

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human placenta shows strong cytoplasmic and membranous positivity in trophoblastic cellss with LAMC1 polyclonal antibody (Cat # PAB30226).

  • Specification

    Product Description

    Rabbit polyclonal antibody raised against partial recombinant human LAMC1.

    Immunogen

    Recombinant protein corresponding to amino acids 1442 - 1552 of human LAMC1.

    Sequence

    STKAEAERTFAEVTDLDNEVNNMLKQLQEAEKELKRKQDDADQDMMMAGMASQAAQEAEINARKAKNSVTSLLSIINDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVS

    Host

    Rabbit

    Reactivity

    Human, Mouse

    Form

    Liquid

    Purification

    Antigen affinity purification

    Isotype

    IgG

    Recommend Usage

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500)
    Western Blot (1:100 - 1:250)
    The optimal working dilution should be determined by the end user.

    Storage Buffer

    In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).

    Storage Instruction

    Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.

    Note

    This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

  • Applications

    Western Blot (Cell lysate)

    Western blot analysis of Lane 1: NIH/3T3 cell lysate and Lane 2: NBT-II cell lysate with LAMC1 polyclonal antibody (Cat # PAB30226).

    Western Blot

    Western blot analysis of Lane 1: RT-4 cell line, Lane 2: U-251MG sp cell line, Lane 3: A-431 cell line, Lane 4: human liver tissue, and Lane 5: human tonsil tissue with LAMC1 polyclonal antibody (Cat # PAB30226).

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

    Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human placenta shows strong cytoplasmic and membranous positivity in trophoblastic cellss with LAMC1 polyclonal antibody (Cat # PAB30226).
  • Gene Info — LAMC1

    Entrez GeneID

    3915

    Protein Accession#

    P11047

    Gene Name

    LAMC1

    Gene Alias

    LAMB2, MGC87297

    Gene Description

    laminin, gamma 1 (formerly LAMB2)

    Omim ID

    150290 176780

    Gene Ontology

    Hyperlink

    Gene Summary

    Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Laminins are composed of 3 non identical chains: laminin alpha, beta and gamma (formerly A, B1, and B2, respectively) and they form a cruciform structure consisting of 3 short arms, each formed by a different chain, and a long arm composed of all 3 chains. Each laminin chain is a multidomain protein encoded by a distinct gene. Several isoforms of each chain have been described. Different alpha, beta and gamma chain isomers combine to give rise to different heterotrimeric laminin isoforms which are designated by Arabic numerals in the order of their discovery, i.e. alpha1beta1gamma1 heterotrimer is laminin 1. The biological functions of the different chains and trimer molecules are largely unknown, but some of the chains have been shown to differ with respect to their tissue distribution, presumably reflecting diverse functions in vivo. This gene encodes the gamma chain isoform laminin, gamma 1. The gamma 1 chain, formerly thought to be a beta chain, contains structural domains similar to beta chains, however, lacks the short alpha region separating domains I and II. The structural organization of this gene also suggested that it had diverged considerably from the beta chain genes. Embryos of transgenic mice in which both alleles of the gamma 1 chain gene were inactivated by homologous recombination, lacked basement membranes, indicating that laminin, gamma 1 chain is necessary for laminin heterotrimer assembly. It has been inferred by analogy with the strikingly similar 3' UTR sequence in mouse laminin gamma 1 cDNA, that multiple polyadenylation sites are utilized in human to generate the 2 different sized mRNAs (5.5 and 7.5 kb) seen on Northern analysis. [provided by RefSeq

    Other Designations

    OTTHUMP00000033450|formerly LAMB2|laminin, gamma 1

  • Interactome
  • Pathway
  • Disease
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All