ODF2 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western blot analysis of Lane 1: Negative control (vector only transfected HEK293T lysate), Lane 2: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells) with ODF2 polyclonal antibody (Cat #PAB30222).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis shows moderate cytoplasmic and nuclear positivity in seminiferous ducts with ODF2 polyclonal antibody (Cat # PAB30222).
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human ODF2.
Immunogen
Recombinant protein corresponding to amino acids 44 - 205 of human ODF2.
Sequence
HKRGMKGDTVNVRRSVRVKTKNPPHCLEITPPSSEKLVSVMRLSDLSTEDDDSGHCKMNRYDKKIDSLMNAVGCLKSEVKMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKE
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500 - 1:1000)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Transfected lysate)
Western blot analysis of Lane 1: Negative control (vector only transfected HEK293T lysate), Lane 2: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells) with ODF2 polyclonal antibody (Cat #PAB30222).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis shows moderate cytoplasmic and nuclear positivity in seminiferous ducts with ODF2 polyclonal antibody (Cat # PAB30222). -
Gene Info — ODF2
Entrez GeneID
4957Protein Accession#
Q5BJF6Gene Name
ODF2
Gene Alias
FLJ44866, MGC111096, MGC9034, ODF2/1, ODF2/2, ODF84
Gene Description
outer dense fiber of sperm tails 2
Omim ID
602015Gene Ontology
HyperlinkGene Summary
The outer dense fibers are cytoskeletal structures that surround the axoneme in the middle piece and principal piece of the sperm tail. The fibers function in maintaining the elastic structure and recoil of the sperm tail as well as in protecting the tail from shear forces during epididymal transport and ejaculation. Defects in the outer dense fibers lead to abnormal sperm morphology and infertility. This gene encodes one of the major outer dense fiber proteins. Multiple protein isoforms are encoded by transcript variants of this gene; however, not all isoforms and variants have been fully described. [provided by RefSeq
Other Designations
OTTHUMP00000022273|OTTHUMP00000022274|cenexin 1|outer dense fiber of sperm tails, 84-kD|outer dense fibre of sperm tails 2|sperm tail structural protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com