Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LYN polyclonal antibody

  • Catalog # : PAB30217
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against partial recombinant human LYN.
  • Immunogen:
  • Recombinant protein corresponding to amino acids 7 - 147 of human LYN.
  • Sequence:
  • KGKDSLSDDGVDLKTQPVRNTERTIYVRDPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAKLNTLETEEWFFKDITRKDAERQLLAPG
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse, Rat
  • Form:
  • Liquid
  • Purification:
  • Antigen affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500)
    Western Blot (1:100 - 1:250)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western blot analysis of Lane 1: NIH/3T3 cell lysate and Lane 2: NBT-II cell lysate with LYN polyclonal antibody (Cat # PAB30217).
  • Western Blot
  • Western Blot
  • Western blot analysis of Lane 1: RT-4 cell line, Lane 2: U-251MG sp cell line, Lane 3: A-431 cell line, Lane 4: human liver tissue, and Lane 5: human tonsil tissue with LYN polyclonal antibody (Cat # PAB30217).
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lymph node shows moderate cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction center with LYN polyclonal antibody (Cat # PAB30217).
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 4067
  • Gene Name:
  • LYN
  • Gene Alias:
  • FLJ26625,JTK8
  • Gene Description:
  • v-yes-1 Yamaguchi sarcoma viral related oncogene homolog
  • Other Designations:
  • Yamaguchi sarcoma viral (v-yes-1) oncogene homolog,Yamaguchi sarcoma viral (v-yes-1) related oncogene homolog
  • RSS
  • YouTube
  • Linkedin
  • Facebook