Product Browser

Last updated: 2016/9/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

KCNH6 polyclonal antibody

  • Catalog # : PAB30161
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against synthetic peptide of human KCNH6.
  • Immunogen:
  • A synthetic peptide corresponding to N-terminus of human KCNH6.
  • Sequence:
  • GKYRTISQIPQFTLNFVEFNLEKHRSSSTTEIEIIAPHKVVERTQNVTEK
  • Host:
  • Rabbit
  • Theoretical MW (kDa):
  • 109
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Protein A purification
  • Recommend Usage:
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
    Western Blot (1.25 ug/mL)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS (2% sucrose, 0.09% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western Blot analysis of Jurkat cell lysate with KCNH6 polyclonal antibody (Cat # PAB30161) at 1.25 ug/mL working concentration.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human brain with KCNH6 polyclonal antibody (Cat # PAB30161) at 4-8 ug/mL working concentration.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Protein Accession#:
  • NP_110406;Q9H252-3
  • Gene Name:
  • KCNH6
  • Gene Alias:
  • ERG2,HERG2,Kv11.2
  • Gene Description:
  • potassium voltage-gated channel, subfamily H (eag-related), member 6
  • Gene Summary:
  • Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit. Several alternatively spliced transcript variants have been identified from this gene, but the full-length nature of only two transcript variants has been determined. [provided by RefSeq
  • Other Designations:
  • eag related protein 2,eag-related gene member 2,ether-a-go-go related gene potassium channel 2,potassium voltage-gated channel, subfamily H, member 6
  • RSS
  • YouTube
  • Linkedin
  • Facebook