KCNH6 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis of Jurkat cell lysate with KCNH6 polyclonal antibody (Cat # PAB30161) at 1.25 ug/mL working concentration.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human brain with KCNH6 polyclonal antibody (Cat # PAB30161) at 4-8 ug/mL working concentration.
-
Specification
Product Description
Rabbit polyclonal antibody raised against synthetic peptide of human KCNH6.
Immunogen
A synthetic peptide corresponding to N-terminus of human KCNH6.
Sequence
GKYRTISQIPQFTLNFVEFNLEKHRSSSTTEIEIIAPHKVVERTQNVTEK
Host
Rabbit
Theoretical MW (kDa)
109
Reactivity
Human
Form
Liquid
Purification
Protein A purification
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (1.25 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS (2% sucrose, 0.09% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of Jurkat cell lysate with KCNH6 polyclonal antibody (Cat # PAB30161) at 1.25 ug/mL working concentration.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human brain with KCNH6 polyclonal antibody (Cat # PAB30161) at 4-8 ug/mL working concentration. -
Gene Info — KCNH6
Entrez GeneID
81033GeneBank Accession#
NM_030779Protein Accession#
NP_110406;Q9H252-3Gene Name
KCNH6
Gene Alias
ERG2, HERG2, Kv11.2
Gene Description
potassium voltage-gated channel, subfamily H (eag-related), member 6
Omim ID
608168Gene Ontology
HyperlinkGene Summary
Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit. Several alternatively spliced transcript variants have been identified from this gene, but the full-length nature of only two transcript variants has been determined. [provided by RefSeq
Other Designations
eag related protein 2|eag-related gene member 2|ether-a-go-go related gene potassium channel 2|potassium voltage-gated channel, subfamily H, member 6
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com