KCNAB3 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against synthetic peptide of human KCNAB3.
Immunogen
A synthetic peptide corresponding to N-terminus of human KCNAB3.
Sequence
RNLGKSGLRVSCLGLGTWVTFGSQISDETAEDVLTVAYEHGVNLFDTAEV
Host
Rabbit
Theoretical MW (kDa)
44
Reactivity
Human
Form
Liquid
Purification
Protein A purification
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (0.65 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS (2% sucrose, 0.09% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of Jurkat cell lysate with KCNAB3 polyclonal antibody (Cat # PAB30160) at 0.65 ug/mL working concentration.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with KCNAB3 polyclonal antibody (Cat # PAB30160) at 4-8 ug/mL working concentration. -
Gene Info — KCNAB3
Entrez GeneID
9196GeneBank Accession#
NM_004732Protein Accession#
NP_004723;O43448Gene Name
KCNAB3
Gene Alias
AKR6A9, KCNA3.1B, KCNA3B, KV-BETA-3, MGC116886
Gene Description
potassium voltage-gated channel, shaker-related subfamily, beta member 3
Omim ID
604111Gene Ontology
HyperlinkGene Summary
Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. This member and the KCNA5 gene product assemble into a heteromultimeric A-type channel that inactivates completely and is significantly faster than other A-type Kv channels. [provided by RefSeq
Other Designations
K+ channel beta-3 subunit|potassium channel, voltage-dependent, beta-3 subunit
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com