ILF2 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis of Jurkat cell lysate with ILF2 polyclonal antibody (Cat # PAB30157) at 1.25 ug/mL working concentration.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney (A) and human heart (B) with ILF2 polyclonal antibody (Cat # PAB30157) at 4-8 ug/mL working concentration.
-
Specification
Product Description
Rabbit polyclonal antibody raised against synthetic peptide of human ILF2.
Immunogen
A synthetic peptide corresponding to C-terminus of human ILF2.
Sequence
HGGFRKILGQEGDASYLASEISTWDGVIVTPSEKAYEKPPEKKEGEEEEE
Host
Rabbit
Theoretical MW (kDa)
43
Reactivity
Human
Form
Liquid
Purification
Protein A purification
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS (2% sucrose, 0.09% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of Jurkat cell lysate with ILF2 polyclonal antibody (Cat # PAB30157) at 1.25 ug/mL working concentration.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney (A) and human heart (B) with ILF2 polyclonal antibody (Cat # PAB30157) at 4-8 ug/mL working concentration. -
Gene Info — ILF2
Entrez GeneID
3608GeneBank Accession#
NM_004515Protein Accession#
NP_004506;Q12905Gene Name
ILF2
Gene Alias
MGC8391, NF45, PRO3063
Gene Description
interleukin enhancer binding factor 2, 45kDa
Omim ID
603181Gene Ontology
HyperlinkGene Summary
Nuclear factor of activated T-cells (NFAT) is a transcription factor required for T-cell expression of the interleukin 2 gene. NFAT binds to a sequence in the interleukin 2 gene enhancer known as the antigen receptor response element 2. In addition, NFAT can bind RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the smaller of which is the product of this gene. The encoded protein binds strongly to the 90 kDa protein and stimulates its ability to enhance gene expression. [provided by RefSeq
Other Designations
interleukin enhancer binding factor 2|nuclear factor of activated T-cells, 45-kDa
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com