IKZF3 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis of HepG2 cell lysate with IKZF3 polyclonal antibody (Cat # PAB30155) at 0.2-1 ug/mL working concentration.
Western Blot (Cell lysate)
Western Blot analysis of human 786-O cell lysate with IKZF3 polyclonal antibody (Cat # PAB30155) at 1 ug/mL working concentration.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human liver with IKZF3 polyclonal antibody (Cat # PAB30155) at 4-8 ug/mL working concentration.
-
Specification
Product Description
Rabbit polyclonal antibody raised against synthetic peptide of human IKZF3.
Immunogen
A synthetic peptide corresponding to N-terminus of human IKZF3.
Sequence
KSTQEQSVPAESAAVLNDYSLTKSHEMENVDSGEGPANEDEDIGDDSMKV
Host
Rabbit
Theoretical MW (kDa)
52
Reactivity
Human
Form
Liquid
Purification
Affinity purification
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS (2% sucrose, 0.09% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of HepG2 cell lysate with IKZF3 polyclonal antibody (Cat # PAB30155) at 0.2-1 ug/mL working concentration.Western Blot (Cell lysate)
Western Blot analysis of human 786-O cell lysate with IKZF3 polyclonal antibody (Cat # PAB30155) at 1 ug/mL working concentration.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human liver with IKZF3 polyclonal antibody (Cat # PAB30155) at 4-8 ug/mL working concentration. -
Gene Info — IKZF3
Entrez GeneID
22806GeneBank Accession#
NM_183228Protein Accession#
NP_899051;Q9UKT9-2Gene Name
IKZF3
Gene Alias
AIO, AIOLOS, ZNFN1A3
Gene Description
IKAROS family zinc finger 3 (Aiolos)
Omim ID
606221Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the Ikaros family of zinc-finger proteins. Three members of this protein family (Ikaros, Aiolos and Helios) are hematopoietic-specific transcription factors involved in the regulation of lymphocyte development. This gene product is a transcription factor that is important in the regulation of B lymphocyte proliferation and differentiation. Both Ikaros and Aiolos can participate in chromatin remodeling. Regulation of gene expression in B lymphocytes by Aiolos is complex as it appears to require the sequential formation of Ikaros homodimers, Ikaros/Aiolos heterodimers, and Aiolos homodimers. At least six alternative transcripts encoding different isoforms have been described. [provided by RefSeq
Other Designations
aiolos|zinc finger protein, subfamily 1A, 3 (Aiolos)
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com