HOXB5 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
Western Blot analysis of human stomach tumor tissue lysate with HOXB5 polyclonal antibody (Cat # PAB30143) at 1 ug/mL working concentration.
Western Blot (Cell lysate)
Western Blot analysis of Jurkat cell lysate with HOXB5 polyclonal antibody (Cat # PAB30143) at 0.2-1 ug/mL working concentration.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human pancreas with HOXB5 polyclonal antibody (Cat # PAB30143) at 4-8 ug/mL working concentration.
-
Specification
Product Description
Rabbit polyclonal antibody raised against synthetic peptide of human HOXB5.
Immunogen
A synthetic peptide corresponding to N-terminus of human HOXB5.
Sequence
MSSYFVNSFSGRYPNGPDYQLLNYGSGSSLSGSYRDPAAMHTGSYGYNYN
Host
Rabbit
Theoretical MW (kDa)
30
Reactivity
Human
Form
Liquid
Purification
Affinity purification
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS (2% sucrose, 0.09% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Tissue lysate)
Western Blot analysis of human stomach tumor tissue lysate with HOXB5 polyclonal antibody (Cat # PAB30143) at 1 ug/mL working concentration.Western Blot (Cell lysate)
Western Blot analysis of Jurkat cell lysate with HOXB5 polyclonal antibody (Cat # PAB30143) at 0.2-1 ug/mL working concentration.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human pancreas with HOXB5 polyclonal antibody (Cat # PAB30143) at 4-8 ug/mL working concentration. -
Gene Info — HOXB5
Entrez GeneID
3215GeneBank Accession#
NM_002147Protein Accession#
NP_002138;P09067Gene Name
HOXB5
Gene Alias
HHO.C10, HOX2, HOX2A, HU-1, Hox2.1
Gene Description
homeobox B5
Omim ID
142960Gene Ontology
HyperlinkGene Summary
This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in lung and gut development. Increased expression of this gene is associated with a distinct biologic subset of acute myeloid leukemia (AML) and the occurrence of bronchopulmonary sequestration (BPS) and congenital cystic adenomatoid malformation (CCAM) tissue. [provided by RefSeq
Other Designations
homeo box 2A|homeo box B5
-
Interactome
-
Publication Reference
-
CXCL12-mediated HOXB5 overexpression facilitates Colorectal Cancer metastasis through transactivating CXCR4 and ITGB3.
Weibo Feng, Wenjie Huang, Jie Chen, Chenyang Qiao, Danfei Liu, Xiaoyu Ji, Meng Xie, Tongyue Zhang, Yijun Wang, Mengyu Sun, Dean Tian, Daiming Fan, Yongzhan Nie, Kaichun Wu, Limin Xia.
Theranostics 2021 Jan; 11(6):2612.
Application：IHC-P, Human, Human colorectal cancer, Human tissue microarray.
-
CXCL12-mediated HOXB5 overexpression facilitates Colorectal Cancer metastasis through transactivating CXCR4 and ITGB3.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com