HNRNPH3 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis of Raji cell lysate with HNRNPH3 polyclonal antibody (Cat # PAB30138) at 1 ug/mL working concentration.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney (A) and human lung (B) with HNRNPH3 polyclonal antibody (Cat # PAB30138) at 4-8 ug/mL working concentration.
-
Specification
Product Description
Rabbit polyclonal antibody raised against synthetic peptide of human HNRNPH3.
Immunogen
A synthetic peptide corresponding to N-terminus of human HNRNPH3.
Sequence
DYQGRSTGEAFVQFASKEIAENALGKHKERIGHRYIEIFRSSRSEIKGFY
Host
Rabbit
Theoretical MW (kDa)
38
Reactivity
Human
Form
Liquid
Purification
Protein A purification
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (1 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS (2% sucrose, 0.09% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of Raji cell lysate with HNRNPH3 polyclonal antibody (Cat # PAB30138) at 1 ug/mL working concentration.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney (A) and human lung (B) with HNRNPH3 polyclonal antibody (Cat # PAB30138) at 4-8 ug/mL working concentration. -
Gene Info — HNRNPH3
Entrez GeneID
3189GeneBank Accession#
NM_012207Protein Accession#
NP_036339;P31942Gene Name
HNRNPH3
Gene Alias
2H9, FLJ34092, HNRPH3
Gene Description
heterogeneous nuclear ribonucleoprotein H3 (2H9)
Omim ID
602324Gene Ontology
HyperlinkGene Summary
This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind to RNAs. It is localized in nuclear bodies of the nucleus. This protein is involved in the splicing process and it also participates in early heat shock-induced splicing arrest by transiently leaving the hnRNP complexes. Several alternatively spliced transcript variants have been noted for this gene, however, not all are fully characterized. [provided by RefSeq
Other Designations
OTTHUMP00000019701|OTTHUMP00000035218|heterogeneous nuclear ribonucleoprotein H3
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com