Product Browser

Last updated: 2016/9/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GPAA1 polyclonal antibody

  • Catalog # : PAB30107
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against synthetic peptide of human GPAA1.
  • Immunogen:
  • A synthetic peptide corresponding to C-terminus of human GPAA1.
  • Sequence:
  • LGSLFLWRELQEAPLSLAEGWQLFLAALAQGVLEHHTYGALLFPLLSLGL
  • Host:
  • Rabbit
  • Theoretical MW (kDa):
  • 67
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Affinity purification
  • Recommend Usage:
  • Immunofluorescence (1:100)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
    Western Blot (0.2-1 ug/mL)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS (2% sucrose, 0.09% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western Blot analysis of HepG2 cell lysate with GPAA1 polyclonal antibody (Cat # PAB30107) at 0.2-1 ug/mL working concentration.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with GPAA1 polyclonal antibody (Cat # PAB30107) at 4-8 ug/mL working concentration.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human liver (A) and human lung (B) with GPAA1 polyclonal antibody (Cat # PAB30107) at 1:100 dilution.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 8733
  • Protein Accession#:
  • NP_003792;O43292
  • Gene Name:
  • GPAA1
  • Gene Alias:
  • GAA1,hGAA1
  • Gene Description:
  • glycosylphosphatidylinositol anchor attachment protein 1 homolog (yeast)
  • Gene Summary:
  • Posttranslational glycosylphosphatidylinositol (GPI) anchor attachment serves as a general mechanism for linking proteins to the cell surface membrane. The protein encoded by this gene presumably functions in GPI anchoring at the GPI transfer step. The mRNA transcript is ubiquitously expressed in both fetal and adult tissues. The anchor attachment protein 1 contains an N-terminal signal sequence, 1 cAMP- and cGMP-dependent protein kinase phosphorylation site, 1 leucine zipper pattern, 2 potential N-glycosylation sites, and 8 putative transmembrane domains. [provided by RefSeq
  • Other Designations:
  • GPAA1P anchor attachment protein 1 homolog,GPI transamidase subunit,anchor attachment protein 1 (Gaa1p, yeast) homolog,glycophosphatidylinositol anchor attachment 1,glycosylphosphatidylinositol anchor attachment protein 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook