GNAS polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against synthetic peptide of human GNAS.
Immunogen
A synthetic peptide corresponding to N-terminus of human GNAS.
Sequence
SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV
Host
Rabbit
Theoretical MW (kDa)
42
Reactivity
Human
Form
Liquid
Purification
Protein A purification
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS (2% sucrose, 0.09% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of Jurkat cell lysate with GNAS polyclonal antibody (Cat # PAB30105) at 2.5 ug/mL working concentration.Western Blot (Cell lysate)
Western Blot analysis of MCF7 cell lysate with GNAS polyclonal antibody (Cat # PAB30105) at 1 ug/mL working concentration.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lung (A) and human kidney (B) with GNAS polyclonal antibody (Cat # PAB30105) at 4-8 ug/mL working concentration. -
Gene Info — GNAS
Entrez GeneID
2778GeneBank Accession#
NM_080426Protein Accession#
NP_536351;Q5FWY2Gene Name
GNAS
Gene Alias
AHO, C20orf45, GNAS1, GPSA, GSA, GSP, MGC33735, NESP, PHP1A, PHP1B, POH, dJ309F20.1.1, dJ806M20.3.3
Gene Description
GNAS complex locus
Gene Ontology
HyperlinkGene Summary
This locus has a highly complex imprinted expression pattern. It gives rise to maternally, paternally, and biallelically expressed transcripts that are derived from four alternative promoters and 5' exons. Some transcripts contains a differentially methylated region (DMR) at their 5' exons, and this DMR is commonly found in imprinted genes and correlates with transcript expression. An antisense transcript is produced from an overlapping locus on the opposite strand. One of the transcripts produced from this locus, and the antisense transcript, are paternally expressed noncoding RNAs, and may regulate imprinting in this region. In addition, one of the transcripts contains a second overlapping ORF, which encodes a structurally unrelated protein - Alex. Alternative splicing of downstream exons is also observed, which results in different forms of the stimulatory G-protein alpha subunit, a key element of the classical signal transduction pathway linking receptor-ligand interactions with the activation of adenylyl cyclase and a variety of cellular reponses. Multiple transcript variants encoding different isoforms have been found for this gene. Mutations in this gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors. [provided by RefSeq
Other Designations
OTTHUMP00000031740|OTTHUMP00000031756|OTTHUMP00000196026|OTTHUMP00000196030|adenylate cyclase-stimulating G alpha protein|guanine nucleotide binding protein (G protein), alpha stimulating activity polypeptide 1|guanine nucleotide regulatory protein|neuroe
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com