GGTLC1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
Western Blot analysis of human fetal kidney tissue lysate with GGTLC1 polyclonal antibody (Cat # PAB30102) at 5 ug/mL working concentration.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with GGTLC1 polyclonal antibody (Cat # PAB30102) at 4-8 ug/mL working concentration.
-
Specification
Product Description
Rabbit polyclonal antibody raised against synthetic peptide of human GGTLC1.
Immunogen
A synthetic peptide corresponding to C-terminus of human GGTLC1.
Sequence
DQEVTAALETRHHHTQITSTFIAVVQAIVRMAGGWAAASDSRKGGEPAGY
Host
Rabbit
Theoretical MW (kDa)
25
Reactivity
Human
Form
Liquid
Purification
Protein A purification
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (5 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS (2% sucrose, 0.09% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Tissue lysate)
Western Blot analysis of human fetal kidney tissue lysate with GGTLC1 polyclonal antibody (Cat # PAB30102) at 5 ug/mL working concentration.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with GGTLC1 polyclonal antibody (Cat # PAB30102) at 4-8 ug/mL working concentration. -
Gene Info — GGTLC1
Entrez GeneID
92086Protein Accession#
Q9BX51Gene Name
GGTLC1
Gene Alias
GGTL6, GGTLA3, GGTLA4, MGC50550, dJ831C21.1, dJ831C21.2
Gene Description
gamma-glutamyltransferase light chain 1
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the gamma-glutamyl transpeptidase (GGT) family, which are important in the metabolism of glutathione. The most ubiquitously expressed human GGT gene, GGT1, encodes a single transmembrane polypeptide that is post-translationally processed to form a heavy and a light chain. In contrast, the product of this gene only contains homology to the light chain region, and lacks a transmembrane domain. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq
Other Designations
OTTHUMP00000030453|OTTHUMP00000030455|OTTHUMP00000030458|gamma-glutamyl transpeptidase|gamma-glutamyltransferase-like activity 3|gamma-glutamyltransferase-like activity 4|gamma-glutamyltransferase-like protein 6|gamma-glutamyltranspeptidase-like
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com