Product Browser

Last updated: 2016/9/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GATA2 polyclonal antibody

  • Catalog # : PAB30096
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against synthetic peptide of human GATA2.
  • Immunogen:
  • A synthetic peptide corresponding to N-terminus of human GATA2.
  • Sequence:
  • PYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSA
  • Host:
  • Rabbit
  • Theoretical MW (kDa):
  • 50
  • Reactivity:
  • Human, Mouse
  • Form:
  • Liquid
  • Purification:
  • Protein A purification
  • Recommend Usage:
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
    Western Blot
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS (2% sucrose, 0.09% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western Blot analysis of K562 cell lysate with GATA2 polyclonal antibody (Cat # PAB30096) at 1-2 ug/mL working concentration.
  • Western Blot
  • Western Blot
  • Western Blot analysis of mouse liver tissue lysate and N2a cell lysate with GATA2 polyclonal antibody (Cat # PAB30096) at 1:500 dilution.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human liver with GATA2 polyclonal antibody (Cat # PAB30096) at 4-8 ug/mL working concentration.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 2624
  • Protein Accession#:
  • NP_116027;P23769
  • Gene Name:
  • GATA2
  • Gene Alias:
  • MGC2306,NFE1B
  • Gene Description:
  • GATA binding protein 2
  • Gene Summary:
  • This gene encodes a member of the GATA family of zinc-finger transcription factors that are named for the consensus nucleotide sequence they bind in the promoter regions of target genes. The encoded protein plays an essential role in regulating transcription of genes involved in the development and proliferation of hematopoietic and endocrine cell lineages. Alternative splicing results in multiple transcript variants
  • Other Designations:
  • GATA-binding protein 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook