GABRD polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
Western Blot analysis of human fetal kidney tissue lysate with GABRD polyclonal antibody (Cat # PAB30091) at 1 ug/mL working concentration.
Western Blot (Cell lysate)
Western Blot analysis of HepG2 cell lysate with GABRD polyclonal antibody (Cat # PAB30091) at 0.2-1 ug/mL working concentration.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human muscle (A) and rat brain (B, C) with GABRD polyclonal antibody (Cat # PAB30091).
-
Specification
Product Description
Rabbit polyclonal antibody raised against synthetic peptide of human GABRD.
Immunogen
A synthetic peptide corresponding to N-terminus of human GABRD.
Sequence
MDAPARLLAPLLLLCAQQLRGTRAMNDIGDYVGSNLEISWLPNLDGLIAG
Host
Rabbit
Theoretical MW (kDa)
51
Reactivity
Human, Rat
Form
Liquid
Purification
Affinity purification
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Western Blot
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS (2% sucrose, 0.09% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Tissue lysate)
Western Blot analysis of human fetal kidney tissue lysate with GABRD polyclonal antibody (Cat # PAB30091) at 1 ug/mL working concentration.Western Blot (Cell lysate)
Western Blot analysis of HepG2 cell lysate with GABRD polyclonal antibody (Cat # PAB30091) at 0.2-1 ug/mL working concentration.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human muscle (A) and rat brain (B, C) with GABRD polyclonal antibody (Cat # PAB30091). -
Gene Info — GABRD
Entrez GeneID
2563GeneBank Accession#
NM_000815Protein Accession#
NP_000806;O14764Gene Name
GABRD
Gene Alias
MGC45284
Gene Description
gamma-aminobutyric acid (GABA) A receptor, delta
Omim ID
137163Gene Ontology
HyperlinkGene Summary
Gamma-aminobutyric acid (GABA) is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. The GABA-A receptor is generally pentameric and there are five types of subunits: alpha, beta, gamma, delta, and rho. This gene encodes the delta subunit. Mutations in this gene have been associated with susceptibility to generalized epilepsy with febrile seizures, type 5. Alternatively spliced transcript variants have been described for this gene, but their biological validity has not been determined. [provided by RefSeq
Other Designations
GABA(A) receptor subunit delta|GABA-A receptor, delta polypeptide|OTTHUMP00000038578
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com