FBXL7 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
Western Blot analysis of human fetal liver tissue lysate with FBXL7 polyclonal antibody (Cat # PAB30072) at 1 ug/mL working concentration.
Western Blot (Cell lysate)
Western Blot analysis of HepG2 cell lysate with FBXL7 polyclonal antibody (Cat # PAB30072) at 1.25 ug/mL working concentration.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with FBXL7 polyclonal antibody (Cat # PAB30072) at 4-8 ug/mL working concentration.
-
Specification
Product Description
Rabbit polyclonal antibody raised against synthetic peptide of human FBXL7.
Immunogen
A synthetic peptide corresponding to N-terminus of human FBXL7.
Sequence
IRLASRPQKEQASIDRLPDHSMVQIFSFLPTNQLCRCARVCRRWYNLAWD
Host
Rabbit
Theoretical MW (kDa)
54
Reactivity
Human
Form
Liquid
Purification
Protein A purification
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS (2% sucrose, 0.09% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Tissue lysate)
Western Blot analysis of human fetal liver tissue lysate with FBXL7 polyclonal antibody (Cat # PAB30072) at 1 ug/mL working concentration.Western Blot (Cell lysate)
Western Blot analysis of HepG2 cell lysate with FBXL7 polyclonal antibody (Cat # PAB30072) at 1.25 ug/mL working concentration.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with FBXL7 polyclonal antibody (Cat # PAB30072) at 4-8 ug/mL working concentration. -
Gene Info — FBXL7
Entrez GeneID
23194GeneBank Accession#
NM_012304Protein Accession#
NP_036436;Q9UJT9Gene Name
FBXL7
Gene Alias
FBL6, FBL7
Gene Description
F-box and leucine-rich repeat protein 7
Omim ID
605656Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains several tandem leucine-rich repeats. [provided by RefSeq
Other Designations
F-box protein Fbl7
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com