FADS1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
Western Blot analysis of human fetal liver tissue lysate with FADS1 polyclonal antibody (Cat # PAB30063) at 1 ug/mL working concentration.
Western Blot (Cell lysate)
Western Blot analysis of K562 cell lysate with FADS1 polyclonal antibody (Cat # PAB30063) at 2.5 ug/mL working concentration.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human muscle with FADS1 polyclonal antibody (Cat # PAB30063) at 4-8 ug/mL working concentration.
-
Specification
Product Description
Rabbit polyclonal antibody raised against synthetic peptide of human FADS1.
Immunogen
A synthetic peptide corresponding to C-terminus of human FADS1.
Sequence
FNDWFSGHLNFQIEHHLFPTMPRHNYHKVAPLVQSLCAKHGIEYQSKPLL
Host
Rabbit
Theoretical MW (kDa)
49
Reactivity
Human
Form
Liquid
Purification
Protein A purification
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS (2% sucrose, 0.09% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Tissue lysate)
Western Blot analysis of human fetal liver tissue lysate with FADS1 polyclonal antibody (Cat # PAB30063) at 1 ug/mL working concentration.Western Blot (Cell lysate)
Western Blot analysis of K562 cell lysate with FADS1 polyclonal antibody (Cat # PAB30063) at 2.5 ug/mL working concentration.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human muscle with FADS1 polyclonal antibody (Cat # PAB30063) at 4-8 ug/mL working concentration. -
Gene Info — FADS1
Entrez GeneID
3992GeneBank Accession#
NM_013402Protein Accession#
NP_037534;O60427Gene Name
FADS1
Gene Alias
D5D, FADS6, FADSD5, FLJ38956, FLJ90273, LLCDL1, TU12
Gene Description
fatty acid desaturase 1
Omim ID
606148Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the fatty acid desaturase (FADS) gene family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family members are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase portion, both of which are characterized by conserved histidine motifs. This gene is clustered with family members FADS1 and FADS2 at 11q12-q13.1; this cluster is thought to have arisen evolutionarily from gene duplication based on its similar exon/intron organization. [provided by RefSeq
Other Designations
delta(5) desaturase|delta-5 desaturase|delta-5 fatty acid desaturase|linoleoyl-CoA desaturase (delta-6-desaturase)-like 1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com