Product Browser

Last updated: 2016/9/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EXOSC4 polyclonal antibody

  • Catalog # : PAB30059
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against synthetic peptide of human EXOSC4.
  • Immunogen:
  • A synthetic peptide corresponding to N-terminus of human EXOSC4.
  • Sequence:
  • SDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHE
  • Host:
  • Rabbit
  • Theoretical MW (kDa):
  • 27
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Protein A purification
  • Recommend Usage:
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
    Western Blot (5 ug/mL)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS (2% sucrose, 0.09% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western Blot analysis of Jurkat cell lysate with EXOSC4 polyclonal antibody (Cat # PAB30059) at 5 ug/mL working concentration.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human heart (A) and human liver (B) with EXOSC4 polyclonal antibody (Cat # PAB30059) at 4-8 ug/mL working concentration.
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Protein Accession#:
  • NP_061910;Q9NPD3
  • Gene Name:
  • EXOSC4
  • Gene Alias:
  • FLJ20591,RRP41,RRP41A,Rrp41p,SKI6,Ski6p,hRrp41p,p12A
  • Gene Description:
  • exosome component 4
  • Other Designations:
  • exosome complex exonuclease RRP41,exosome component Rrp41,ribosomal RNA-processing protein 41
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook