EVX1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
Western Blot analysis of human fetal lung tissue lysate with EVX1 polyclonal antibody (Cat # PAB30055) at 1 ug/mL working concentration.
Western Blot (Cell lysate)
Western Blot analysis of Jurkat cell lysate with EVX1 polyclonal antibody (Cat # PAB30055) at 1-2 ug/mL working concentration.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney (A) and human lung (B) with EVX1 polyclonal antibody (Cat # PAB30055) at 4-8 ug/mL working concentration.
-
Specification
Product Description
Rabbit polyclonal antibody raised against synthetic peptide of human EVX1.
Immunogen
A synthetic peptide corresponding to N-terminus of human EVX1.
Sequence
AGSAAGPGAEPQVAGAAMLGPGPPAPSVDSLSGQGQPSSSDTESDFYEEI
Host
Rabbit
Theoretical MW (kDa)
42
Reactivity
Human
Form
Liquid
Purification
Protein A purification
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS (2% sucrose, 0.09% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Tissue lysate)
Western Blot analysis of human fetal lung tissue lysate with EVX1 polyclonal antibody (Cat # PAB30055) at 1 ug/mL working concentration.Western Blot (Cell lysate)
Western Blot analysis of Jurkat cell lysate with EVX1 polyclonal antibody (Cat # PAB30055) at 1-2 ug/mL working concentration.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney (A) and human lung (B) with EVX1 polyclonal antibody (Cat # PAB30055) at 4-8 ug/mL working concentration. -
Gene Info — EVX1
Entrez GeneID
2128GeneBank Accession#
NM_001989Protein Accession#
NP_001980;P49640Gene Name
EVX1
Gene Alias
-
Gene Description
even-skipped homeobox 1
Omim ID
142996Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the even-skipped homeobox family characterized by the presence of a homeodomain closely related to the Drosophila even-skipped (eve) segmentation gene of the pair-rule class. The encoded protein may play an important role as a transcriptional repressor during embryogenesis. [provided by RefSeq
Other Designations
eve, even-skipped homeo box homolog 1|eve, even-skipped homeobox homolog 1|even-skipped homeo box 1 (homolog of Drosophila)
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com