Product Browser

Last updated: 2016/9/18

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ENO1 polyclonal antibody

  • Catalog # : PAB30050
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against synthetic peptide of human ENO1.
  • Immunogen:
  • A synthetic peptide corresponding to internal region of human ENO1.
  • Sequence:
  • VAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDP
  • Host:
  • Rabbit
  • Theoretical MW (kDa):
  • 47
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Affinity purification
  • Recommend Usage:
  • Immunofluorescence (1:100)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
    Western Blot
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS (2% sucrose, 0.09% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • Western Blot analysis of human heart tissue lysate with ENO1 polyclonal antibody (Cat # PAB30050) at 1 ug/mL working concentration.
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • Western Blot analysis of human fetal small intestine tissue lysate with ENO1 polyclonal antibody (Cat # PAB30050) at 0.03 ug/mL working concentration.
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • Western Blot analysis of human liver tissue lysate with ENO1 polyclonal antibody (Cat # PAB30050) at 1 ug/mL working concentration.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney (A) and human placenta (B) with ENO1 polyclonal antibody (Cat # PAB30050) at 4-8 ug/mL working concentration.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of human heart with ENO1 polyclonal antibody (Cat # PAB30050) at 1:100 dilution.
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 2023
  • Protein Accession#:
  • NP_001419;P06733
  • Gene Name:
  • ENO1
  • Gene Alias:
  • ENO1L1,MBP-1,MPB1,NNE,PPH
  • Gene Description:
  • enolase 1, (alpha)
  • Gene Summary:
  • This gene encodes one of three enolase isoenzymes found in mammals; it encodes alpha-enolase, a homodimeric soluble enzyme, and also encodes a shorter monomeric structural lens protein, tau-crystallin. The two proteins are made from the same message. The full length protein, the isoenzyme, is found in the cytoplasm. The shorter protein is produced from an alternative translation start, is localized to the nucleus, and has been found to bind to an element in the c-myc promoter. A pseudogene has been identified that is located on the other arm of the same chromosome. [provided by RefSeq
  • Other Designations:
  • 2-phospho-D-glycerate hydro-lyase,MYC promoter-binding protein 1,OTTHUMP00000001706,alpha enolase like 1,enolase 1,non-neural enolase,phosphopyruvate hydratase,tau-crystallin
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook