ENO1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
Western Blot analysis of human fetal small intestine tissue lysate with ENO1 polyclonal antibody (Cat # PAB30050) at 0.03 ug/mL working concentration.
Western Blot (Tissue lysate)
Western Blot analysis of human liver tissue lysate with ENO1 polyclonal antibody (Cat # PAB30050) at 1 ug/mL working concentration.
Western Blot (Tissue lysate)
Western Blot analysis of human heart tissue lysate with ENO1 polyclonal antibody (Cat # PAB30050) at 1 ug/mL working concentration.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney (A) and human placenta (B) with ENO1 polyclonal antibody (Cat # PAB30050) at 4-8 ug/mL working concentration.
Immunofluorescence
Immunofluorescent staining of human heart with ENO1 polyclonal antibody (Cat # PAB30050) at 1:100 dilution.
-
Specification
Product Description
Rabbit polyclonal antibody raised against synthetic peptide of human ENO1.
Immunogen
A synthetic peptide corresponding to internal region of human ENO1.
Sequence
VAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDP
Host
Rabbit
Theoretical MW (kDa)
47
Reactivity
Human
Form
Liquid
Purification
Affinity purification
Recommend Usage
Immunofluorescence (1:100)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS (2% sucrose, 0.09% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Tissue lysate)
Western Blot analysis of human fetal small intestine tissue lysate with ENO1 polyclonal antibody (Cat # PAB30050) at 0.03 ug/mL working concentration.Western Blot (Tissue lysate)
Western Blot analysis of human liver tissue lysate with ENO1 polyclonal antibody (Cat # PAB30050) at 1 ug/mL working concentration.Western Blot (Tissue lysate)
Western Blot analysis of human heart tissue lysate with ENO1 polyclonal antibody (Cat # PAB30050) at 1 ug/mL working concentration.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney (A) and human placenta (B) with ENO1 polyclonal antibody (Cat # PAB30050) at 4-8 ug/mL working concentration.Immunofluorescence
Immunofluorescent staining of human heart with ENO1 polyclonal antibody (Cat # PAB30050) at 1:100 dilution. -
Gene Info — ENO1
Entrez GeneID
2023GeneBank Accession#
NM_001428Protein Accession#
NP_001419;P06733Gene Name
ENO1
Gene Alias
ENO1L1, MBP-1, MPB1, NNE, PPH
Gene Description
enolase 1, (alpha)
Omim ID
172430Gene Ontology
HyperlinkGene Summary
This gene encodes one of three enolase isoenzymes found in mammals; it encodes alpha-enolase, a homodimeric soluble enzyme, and also encodes a shorter monomeric structural lens protein, tau-crystallin. The two proteins are made from the same message. The full length protein, the isoenzyme, is found in the cytoplasm. The shorter protein is produced from an alternative translation start, is localized to the nucleus, and has been found to bind to an element in the c-myc promoter. A pseudogene has been identified that is located on the other arm of the same chromosome. [provided by RefSeq
Other Designations
2-phospho-D-glycerate hydro-lyase|MYC promoter-binding protein 1|OTTHUMP00000001706|alpha enolase like 1|enolase 1|non-neural enolase|phosphopyruvate hydratase|tau-crystallin
-
Interactome
-
Pathway
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Glycolysis / Gluconeogenesis
- Metabolic pathways
+ View More Disease
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com