E2F4 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis of HepG2 cell lysate with E2F4 polyclonal antibody (Cat # PAB30041) at 0.2-1 ug/mL working concentration.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human intestine (A) and human stomach (B) with E2F4 polyclonal antibody (Cat # PAB30041) at 4-8 ug/mL working concentration.
-
Specification
Product Description
Rabbit polyclonal antibody raised against synthetic peptide of human E2F4.
Immunogen
A synthetic peptide corresponding to C-terminus of human E2F4.
Sequence
SSELLEELMSSEVFAPLLRLSPPPGDHDYIYNLDESEGVCDLFDVPVLNL
Host
Rabbit
Theoretical MW (kDa)
44
Reactivity
Human
Form
Liquid
Purification
Affinity purification
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (0.2-1 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS (2% sucrose, 0.09% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of HepG2 cell lysate with E2F4 polyclonal antibody (Cat # PAB30041) at 0.2-1 ug/mL working concentration.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human intestine (A) and human stomach (B) with E2F4 polyclonal antibody (Cat # PAB30041) at 4-8 ug/mL working concentration. -
Gene Info — E2F4
Entrez GeneID
1874GeneBank Accession#
NM_001950Protein Accession#
NP_001941;Q16254Gene Name
E2F4
Gene Alias
E2F-4
Gene Description
E2F transcription factor 4, p107/p130-binding
Omim ID
600659Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein binds to all three of the tumor suppressor proteins pRB, p107 and p130, but with higher affinity to the last two. It plays an important role in the suppression of proliferation-associated genes, and its gene mutation and increased expression may be associated with human cancer. [provided by RefSeq
Other Designations
E2F transcription factor 4|p107/p130-binding protein
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com