DMTF1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis of HepG2 cell lysate with DMTF1 polyclonal antibody (Cat # PAB30039) at 0.2-1 ug/mL working concentration.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human intestine with DMTF1 polyclonal antibody (Cat # PAB30039) at 4-8 ug/mL working concentration.
-
Specification
Product Description
Rabbit polyclonal antibody raised against synthetic peptide of human DMTF1.
Immunogen
A synthetic peptide corresponding to C-terminus of human DMTF1.
Sequence
SFNDAHVSKFSDQNSTELMNSVMVRTEEEISDTDLKQEESPSDLASAYVT
Host
Rabbit
Theoretical MW (kDa)
54
Reactivity
Human
Form
Liquid
Purification
Affinity purification
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (0.2-1 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS (2% sucrose, 0.09% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of HepG2 cell lysate with DMTF1 polyclonal antibody (Cat # PAB30039) at 0.2-1 ug/mL working concentration.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human intestine with DMTF1 polyclonal antibody (Cat # PAB30039) at 4-8 ug/mL working concentration. -
Gene Info — DMTF1
Entrez GeneID
9988GeneBank Accession#
NM_001142326Protein Accession#
EAW76962;Q9Y222Gene Name
DMTF1
Gene Alias
DMP1, DMTF, FLJ25188, FLJ41265, FLJ76054, hDMP1
Gene Description
cyclin D binding myb-like transcription factor 1
Omim ID
608491Gene Ontology
HyperlinkGene Summary
This gene encodes a transcription factor that contains a cyclin D-binding domain, three central Myb-like repeats, and two flanking acidic transactivation domains at the N- and C-termini. The encoded protein is induced by the oncogenic Ras signaling pathway and functions as a tumor suppressor by activating the transcription of ARF and thus the ARF-p53 pathway to arrest cell growth or induce apoptosis. It also activates the transcription of aminopeptidase N and may play a role in hematopoietic cell differentiation. The transcriptional activity of this protein is regulated by binding of D-cyclins. This gene is hemizygously deleted in approximately 40% of human non-small-cell lung cancer and is a potential prognostic and gene-therapy target for non-small-cell lung cancer. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
cyclin D-binding Myb-like protein 1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com