DDX47 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis of Jurkat cell lysate with DDX47 polyclonal antibody (Cat # PAB30028) at 1.25 ug/mL working concentration.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human liver with DDX47 polyclonal antibody (Cat # PAB30028) at 4-8 ug/mL working concentration.
-
Specification
Product Description
Rabbit polyclonal antibody raised against synthetic peptide of human DDX47.
Immunogen
A synthetic peptide corresponding to C-terminus of human DDX47.
Sequence
AQRFARMELREHGEKKKRSREDAGDNDDTEGAIGVRNKVAGGKMKKRKGR
Host
Rabbit
Theoretical MW (kDa)
50
Reactivity
Human
Form
Liquid
Purification
Protein A purification
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (1.25 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS (2% sucrose, 0.09% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of Jurkat cell lysate with DDX47 polyclonal antibody (Cat # PAB30028) at 1.25 ug/mL working concentration.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human liver with DDX47 polyclonal antibody (Cat # PAB30028) at 4-8 ug/mL working concentration. -
Gene Info — DDX47
Entrez GeneID
51202GeneBank Accession#
NM_016355Protein Accession#
NP_057439;Q9H0S4Gene Name
DDX47
Gene Alias
DKFZp564O176, E4-DBP, FLJ30012, HQ0256, MSTP162
Gene Description
DEAD (Asp-Glu-Ala-Asp) box polypeptide 47
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene can shuttle between the nucleus and the cytoplasm, and has an RNA-independent ATPase activity. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq
Other Designations
DEAD box polypeptide 47|E4-DEAD box protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com