DDX17 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis of Jurkat cell lysate with DDX17 polyclonal antibody (Cat # PAB30026) at 1.25 ug/mL working concentration.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney (A) and human lung (B) with DDX17 polyclonal antibody (Cat # PAB30026) at 4-8 ug/mL working concentration.
-
Specification
Product Description
Rabbit polyclonal antibody raised against synthetic peptide of human DDX17.
Immunogen
A synthetic peptide corresponding to N-terminus of human DDX17.
Sequence
TSSANNPNLMYQDECDRRLRGVKDGGRRDSASYRDRSETDRAGYANGSGY
Host
Rabbit
Theoretical MW (kDa)
60
Reactivity
Human
Form
Liquid
Purification
Protein A purification
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (1.25 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS (2% sucrose, 0.09% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of Jurkat cell lysate with DDX17 polyclonal antibody (Cat # PAB30026) at 1.25 ug/mL working concentration.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney (A) and human lung (B) with DDX17 polyclonal antibody (Cat # PAB30026) at 4-8 ug/mL working concentration. -
Gene Info — DDX17
Entrez GeneID
10521GeneBank Accession#
NM_001098504Protein Accession#
EAW60248;Q92841Gene Name
DDX17
Gene Alias
DKFZp761H2016, P72, RH70
Gene Description
DEAD (Asp-Glu-Ala-Asp) box polypeptide 17
Omim ID
608469Gene Ontology
HyperlinkGene Summary
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and splicesosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is an ATPase activated by a variety of RNA species, but not by dsDNA. This protein, and that encoded by DDX5 gene, are more closely related to each other than to any other member of the DEAD box family. Several alternatively spliced transcripts encoding different isoforms, some of which use non-AUG (CUG) translation initiation codon, have been described for this gene. [provided by RefSeq
Other Designations
DEAD box polypeptide 17|DEAD box protein p72|DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 17 (72kD)|DEAD/H box 17|OTTHUMP00000028920|RNA-dependent helicase p72
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com