DAZ4 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis of HepG2 cell lysate with DAZ4 polyclonal antibody (Cat # PAB30018) at 0.2-1 ug/mL working concentration.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney (A) and human stomach (B) with DAZ4 polyclonal antibody (Cat # PAB30018) at 4-8 ug/mL working concentration.
-
Specification
Product Description
Rabbit polyclonal antibody raised against synthetic peptide of human DAZ4.
Immunogen
A synthetic peptide corresponding to N-terminus of human DAZ4.
Sequence
MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDAR
Host
Rabbit
Theoretical MW (kDa)
36
Reactivity
Human
Form
Liquid
Purification
Affinity purification
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (0.2-1 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS (2% sucrose, 0.09% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of HepG2 cell lysate with DAZ4 polyclonal antibody (Cat # PAB30018) at 0.2-1 ug/mL working concentration.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney (A) and human stomach (B) with DAZ4 polyclonal antibody (Cat # PAB30018) at 4-8 ug/mL working concentration. -
Gene Info — DAZ4
Entrez GeneID
57135GeneBank Accession#
NM_001005375Protein Accession#
AAF91331;Q86SG3Gene Name
DAZ4
Gene Alias
DAZ, DAZ1, pDP1680, pDP1681
Gene Description
deleted in azoospermia 4
Gene Ontology
HyperlinkGene Summary
This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). Its expression is restricted to premeiotic germ cells, particularly in spermatogonia. It encodes an RNA-binding protein that is important for spermatogenesis. Four copies of this gene are found on chromosome Y within palindromic duplications; one pair of genes is part of the P2 palindrome and the second pair is part of the P1 palindrome. Each gene contains a 2.4 kb repeat including a 72-bp exon, called the DAZ repeat; the number of DAZ repeats is variable and there are several variations in the sequence of the DAZ repeat. Each copy of the gene also contains a 10.8 kb region that may be amplified; this region includes five exons that encode an RNA recognition motif (RRM) domain. This gene contains two copies of the 10.8 kb repeat. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
deleted in azoospermia 1
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com